Genetics: From Genes to Genomes
6th Edition
ISBN: 9781259700903
Author: Leland Hartwell Dr., Michael L. Goldberg Professor Dr., Janice Fischer, Leroy Hood Dr.
Publisher: McGraw-Hill Education
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 19, Problem 4P
Hypomorphic mutations in the wingless gene of Drosophila result in animals lacking wings.
| a. | Starting with a set of wingless mutations, how could researchers have identified the wingless gene in the Drosophila genome sequence? |
| b. | Part of the amino acid sequence encoded by the ORF of the wingless gene is: (N)…EAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRL…(C) Perform a protein blast at the following website to ask whether the human genome has a gene related to the fly wingless gene: https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome Enter Homo sapiens (taxid:9606) as the organism. Leave all the other settings in their default state, and hit the blue BLAST button at the bottom of the page. The results of the database search will appear in a few minutes. What do the results of the search tell you about the existence of human genes homologous to the fly wingless gene? |
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
The sequence below (A) was read from the autoradiogram (B).
(A)
5' TGTACAACTTTTACTTAGGGCCGTGACACCTAAAG. 3'
(B)
Negative end
ACGT
Positive end
C.
Compare the sequence to the autoradiogram. How is the sequence read? Explain your ans
d.
Suppose that you want to express the correct protein product of an eukaryotic gene in a bacterial cell using a plasmid
vector. What single sequence related factor must your consider in the cloning experiment?
Refer to the DNA sequence provided:
3’ -TACTGAAGCGGCAGCCCCGCATGAGTAGACCTTACT-5’
a. What is the mRNA transcript of the anticoding strand of the DNA model?
b. What is the amino acid sequence of the polypeptide chain that will be translated from the mRNA in (a)?
A recent genome sequencing project for the bacterium Burkholderia mallei has identified a new protein with high similarity to the lysylphosphatidylglycerol flippase enzyme. A short section of the new protein sequence is shown below. TVEVNAPGDVQKALSELQQINDGRLDIRI (a) Are any reverse turns likely to be present? Explain your answer. (b) Are any beta-strands likely to be present? Explain your answer. (c) Are any alpha helices likely to be present? Explain your answer. (d) Is any supersecondary structure likely to be present? Explain your answer. (e) Identify two residues that are likely to be buried in the core of the folded protein. Explain your answer. (f) Identify two residues that are likely to be hydrogen bonded to each other. Explain your answer.
Chapter 19 Solutions
Genetics: From Genes to Genomes
Ch. 19 - Match each of the terms in the left column to the...Ch. 19 - a. If you were interested in the role of a...Ch. 19 - Early C. elegans embryos display mosaic...Ch. 19 - Hypomorphic mutations in the wingless gene of...Ch. 19 - Prob. 5PCh. 19 - In 1932, H. J. Muller suggested a genetic test to...Ch. 19 - a. Explain how you could use worms transformed...Ch. 19 - Suppose you want to determine whether a particular...Ch. 19 - Sevenless is an unusual receptor protein in that...Ch. 19 - Suppose that you generated flies containing a...
Ch. 19 - Drosophila researchers have collected many strains...Ch. 19 - As an alternative to random mutagenesis,...Ch. 19 - A C. elegans nematode gene called par-1 helps to...Ch. 19 - The molecular identity of the fruit fly rugose...Ch. 19 - To determine the focus of action of boss,...Ch. 19 - Suppose a particular gene is required for early...Ch. 19 - Researchers have exploited Minute mutations in...Ch. 19 - Some ts alleles are temperature sensitive during...Ch. 19 - The following figure shows the temperature-shift...Ch. 19 - A temperature-sensitive allele of the gene...Ch. 19 - Hypomorphic alleles of a pleiotropic gene...Ch. 19 - In addition to the maternal effect genes that...Ch. 19 - The yan gene encodes a transcription factor that...Ch. 19 - Recall from Chapter 17 that in Drosophila, sex...Ch. 19 - a. Explain the difference between maternal...Ch. 19 - In the 1920s, Arthur Boycott, working with the...Ch. 19 - The Drosophila mutant screen shown on the...Ch. 19 - Some genes are required both zygotically and...Ch. 19 - How would a human with a mutation in a maternal...Ch. 19 - One important demonstration that Bicoid is an...Ch. 19 - The hunchback gene contains a 5 transcriptional...Ch. 19 - In flies developing from eggs laid by a...Ch. 19 - Wild-type embryos and mutant embryos lacking the...Ch. 19 - The Drosophila even-skipped eve gene has four...Ch. 19 - In Drosophila with loss-of-function mutations...Ch. 19 - It is crucial to the development of Drosophila...Ch. 19 - In the plant Arabidopsis thaliana, every flower is...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Template strand of DNA is: 3’ TACATAACCGGGCCCATATCGGCCATTTGC5’. 2a). Following transcription, what is the total number of codons in the mRNA transcript? 2 b). Where is the start codon located in this mRNA transcript? 2c). Following translation of this mRNA transcript, how many amino acids will the proteincontain and identify the amino acids sequence of this gene from a genetic code table*.*Note= using a genetic code tablearrow_forwardRefer to the DNA sequence provided:3’ -TACTGAAGCGGCAGCCCCGCATGAGTAGACCTTACT-5’ b. What is the amino acid sequence of the polypeptide chain that will be translated from the mRNAin (a)? (The question for A is this: What is the mRNA transcript of the anticoding strand of the DNA model?)arrow_forwardA molecular geneticist hopes to find a Gene in human liver cell that codes for an important blood-clotting protein,he knows that the nucleotide sequence of a small part of the Gene is GTGGACTGACA.briefly explain how to obtain genearrow_forward
- Annotation of the human genome sequence reveals a discrepancy between the number of protein-coding genes and the number of predicted proteins actually expressed by the genome. Proteomic analysis indicates that human cells are capable of synthesizing more than 100,000 different proteins and perhaps three times this number. What is the discrepancy, and how can it be reconciled?arrow_forwardYou would like to add a nuclear localization sequence (NLS) of Lys-Lys-Lys-Arg-Lys to a protein that is usually found in the cytoplasm of a yeast cell. To accomplish this, you introduce the nucleotide sequence encoding the NLS into the gene that encodes the cytoplasmic protein of interest. a. What is the size of the nucleotide insert that will encode the NLS? Briefly explain. 5' 3' b. Below is a diagram of the gene encoding the cytoplasmic protein of interest in the yeast genome. If your goal is to put the NLS at the carboxyl (C) terminus of the protein, at which location (A-E) should the NLS be inserted? Briefly explain. A TATAA ATATT promoter +1 B ATG TAC D TAA ATT stop codon E 3' 5'arrow_forwardQ.) A.)Search in human genome if any examples of mRNA translated from 2 different sites?and give examples? B.)aminoacyl tRNA synthetase is specialized or not ? And why?arrow_forward
- a molecular geneticist hopes to find a gene in human liver cells that codes for an important blood-clotting protein. he knows that the nucleotide sequence of a small part of the gene is gtggactgaca. briefly explain how to obtain the desired gene answerarrow_forward2a) Suppose you have a gene in which a single base substitution has created the nonsense mutation 5'TAA3' (which will be transcribed into 5'UAA3' in the mRNA - but recall that mutations are changes in the DNA sequence). Name all the amino acids that could have been coded for by the original, unmutated codon at that position in the gene.arrow_forwardA. What amino acid sequence is encoded by the codon sequence AUAAUGGUAACGGUU? B. Suppose the codon sequence AGACACUCUAUUAAA has a single base pair mutation to AGACACUCUUUUAAA. If the old protein sequence was Arg-His-Ser-Ile-Lys, what will be the new sequence encoded by the mutant gene?arrow_forward
- 30 A DNA sequence encoding a five-amino acid polypeptide is given below. …ACGGCAAGATCCCACCCTAATCAGACCGTACCATTCACCTCCT… …TGCCGTTCTAGGGTGGGATTAGTCTGGCATGGTAAGTGGAGGA… b)Give the sequence and polarity of the mRNA encoding the polypeptide. Please explain step-by-step how exactly you go from the DNA sequence given to the final answer.arrow_forwardConsider the following portion of mRNA produced by the normal order of DNA nucleotides: 5’ – CUU AAA CCA GUU – 3’ a. What is the template DNA sequence that was used to synthesize this portion of mRNA? b. What is the amino acid order produced from this mRNA? c. Write the amino acid sequence if a mutation changes CUU to CAU. Is this likely to affect protein function?arrow_forward30 A DNA sequence encoding a five-amino acid polypeptide is given below. …ACGGCAAGATCCCACCCTAATCAGACCGTACCATTCACCTCCT… …TGCCGTTCTAGGGTGGGATTAGTCTGGCATGGTAAGTGGAGGA… d) Assuming the sequence above is a bacterial gene, identify the region encoding the Shine-Dalgarno sequence. e) What is the function of the shine Dalgarno sequence?arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Heredity: Principles and Issues (MindTap Co...BiologyISBN:9781305251052Author:Michael CummingsPublisher:Cengage Learning
Human Heredity: Principles and Issues (MindTap Co...
Biology
ISBN:9781305251052
Author:Michael Cummings
Publisher:Cengage Learning
Genome Annotation, Sequence Conventions and Reading Frames; Author: Loren Launen;https://www.youtube.com/watch?v=MWvYgGyqVys;License: Standard Youtube License