Q: POTENTIAL IMPACT OF "Land use effect on benthic micro-invertebrate communities in streams".
A: Land use is a major global concern because the disturbances caused by it result in soil erosion,…
Q: Step 1: select two different species (one eukaryotic and another prokaryotic and do the taxonomy.…
A: Introduction:- Living organisms are classified into different groups on the basis of similarity and…
Q: Which of the following vaccines is a conjugate vaccine? A. Hepatitis B B. Hepatitis A C. COVID-19 D.…
A: Introduction Immunization or vaccination is a type of simple and effective way to protect our body…
Q: Which of the following life stages is the parasitic stage of Unionidae mussels? Question 3…
A: Unionidae mussels are the largest family of freshwater mussels belonging to the order Unionida. They…
Q: Use the graph to justify why DNA alone does not determine susceptibility to disease in identical and…
A: DNA is the genetic material in most living organisms. It is the information hub of the cell that…
Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…
A: Peptide 1 is migrate most slowly during size exclusion chromatography
Q: moose the correct option NA repair is necessary because : -) DNA replication results in…
A: DNA repair is a process in which the wrong and inserted bases are removed and replaced by the…
Q: what are the nutrition facts and calories showing calculation for all IV infusions including: 1)…
A: The infusion provides potassium ions, which are essential for maintaining normal cellular function,…
Q: In your own words explain endomysium and its function
A: Tissue is a group of cells that have a common origin and functions together to form specialised…
Q: Using the genetic code table provided below, identify the open reading frame in this mRNA sequence,…
A:
Q: 17. Which part of the human body can be removed and would not affect normal function of the body at…
A: The human body can be called a highly structured organization that is both intricate and…
Q: i) What is the most likely mode of inheritance for this pedigree? ii) State the genotypes of…
A: In order to study a Pedigree the first and foremost thing which is required is to know the pattern…
Q: what marijuana can do to a person's mind, body, and health
A: Marijuana is a psychoactive drug produced by the Cannabis plant. It is mainly used for the…
Q: Herpes simplex virus and cytomegalovirus are both in the herpes virus family, but of the two, only…
A: A drug is a chemical substance given to an individual to prevent or cure a disease. Many microbial…
Q: Primary immunodeficiency disorders
A: Immunodeficiency: It is the absence or result of elements of the immune system such as phagocytes,…
Q: Compare and contrast the receptor-binding proteins of the envelope and the receptor used by the…
A: SARS - COV- 2 stands for severe acute respiratory syndrome coronavirus virus 2. It is highly…
Q: Which of the following should be done before organ transplantation? 1. Blood group typing II. HLA…
A: An organ is removed from one body and placed in the body of the recipient during an organ transplant…
Q: (75) A 6-year-old is brought to the physician for a follow-up examination because of recurrent life…
A: The immune system's capacity to operate correctly is impacted by immunodeficiency diseases. These…
Q: Compare the digestive, respiratory and circulatory system of E coli bacteria and Cactus, then…
A: We all know that E.coli is a bacteria which is mainly a prokaryotic cell and Cactus is mainly a…
Q: Which of the following could attribute to variation within a species? Choose all that apply.…
A: Variation within a species is the diversity of characteristics that exist among different members of…
Q: Why is cell differentiation important to polar bears?
A: Polar bears are significant threats to human lives and property because they are strong predators.…
Q: 8. What is a mutation? 9. What is sickle cell anemia? 10. What is hemophilia?
A: Introduction A gene is the physical and functional unit of heredity. They pass information from one…
Q: What would be the effect of increased (or decreased) concentration of extracellular Ca2+ on the…
A: "Neurotransmitters can serve as chemical messengers for ion channels, neurotransmitter mainly causes…
Q: 10. The animals being raised in CAFOS get their than them and roaming to find food. 11. With the…
A: The livestock sector plays a significant role in the world's food system, helping to reduce poverty,…
Q: ur answer. Table 1 Genotype (i) I-P+O+Z+y+ (ii) I+P+OCZ+y+ (iii) ISP+O+Z+Y+ (iv)…
A: First understand what is lac operon 1. In lac operon there are certain genes and a promoter in…
Q: The gene for red-green color blindness is recessive and X-linked. What will be the expected…
A: Human eyes are capable of detecting three colours: red, green, and blue. These colours are…
Q: What are the variations in the spores of genus Thelypteris
A: Thelypteris is a genus of ferns that belongs to the family Thelypteridaceae, subfamily…
Q: 3. Draw the needed cells and identify the number of chromosomes Scenarios A parent somatic cell with…
A: Somatic cell is a diploid cell which contains chromosomes in pairs. Haploid cell means that…
Q: airway resistance
A: Airway Resistance: It is defined as the measurement of impedance(amount of resistance) to the…
Q: Which are correct regarding blood pressure? [Select all that apply] a. Blood pressure decreases as…
A: Blood pressure is the measure of force exerted by the blood on the walls of the arteries. It can be…
Q: Figure 3 shows translation elongation in progress. What is the structure labelled A, B, C and D in…
A: Translation is the process of copying the information on an mRNA into a sequence of amino acids to…
Q: Discuss the role of each of these factors in the causation of the COVID 19 pandemic: zoonotic…
A: Coronavirus is a single-stranded RNA virus with an envelope. As suggested by the name, it is a…
Q: mutations that happened to the cactus (eukarotic cells)
A: Mutation is a loss or sudden change in DNA sequence it happens where one or more nucleotide is…
Q: 4. If a mutation occurred within the chromosome ABcDefgHI that changed the genetic information to…
A: A "mutation in a gene that codes for a protein involved in a crucial biological process, such as DNA…
Q: Select a type of microscope and specimen preparation method to observe the following biological…
A: Cancer is one of those diseases which if not detected on time, will cost a life. So, accuracy,…
Q: Figure 1 shows a schematic of an action potential. How do voltage-gated sodium channels contribute…
A: A neuron can take input from the other neurons and, if the input is powerful enough, convey the…
Q: Sickle cell anemia is an example of a genetic disease caused by a point mutation. To answer this…
A: Introduction - Sickle Cell AnemiaIn sickle cell anemia, the red blood cells become rigid and sticky…
Q: 8. Which animals are the most closely related based on the chart below? Common name Bobcat Jaguar…
A: Animal kingdom is divided is one of the most advanced Kingdom. Organisms present are range from…
Q: Describe how histones including H2A, H2B, H3 and H4 play a critical role in DNA packaging.
A: DNA is a vital component of life and has multiple important functions that underpin the biology and…
Q: Very briefly discuss and characterise insulin including its main actions.
A: Insulin: Insulin is a type of hormone that is primarily responsible to allow glucose in the blood to…
Q: Which of the following materials can cause a patient to develop hypersensitivity when used in either…
A: The femoral head and acetabular liner components of total hip replacement can be broken down into…
Q: differentiate the oogenesis and spermatogenesis of chicken and fruitfly.
A: Oogenesis is the process of egg cell production in female organisms, while spermatogenesis is the…
Q: Explain how eukaryotic cells originated from prokaryotic cells/ ‘invasion happened to their simple…
A: According to the endosymbiotic theory, some eukaryotic cell organelles, such mitochondria and…
Q: Required: Write four problems/ pains for which a solution is needed. Problem could be general or…
A: Biology is a vast and complex field that is constantly uncovering new insights about the natural…
Q: FILL IN THE BLANKS 1. Examples of a fat soluble vitamin are …… , …….. And examples of water…
A: Biomolecules are the macro and micromolecules produced and secreted by biological cells. proteins,…
Q: Causes of global warming explain briefly
A: The gradual increase in earth's temperature is referred to as global warming, which is a component…
Q: Describe the inside of hyphae
A: Hyphae are produced by fungi. These are long and have branching and can be seen in number of…
Q: For the E.coli. bacteria (prokaryotic species) and humans (eukaryotic species), show photos of their…
A: ANSWER: DNA is located in the cytoplasm of both nucleated and nucleus-less eukaryotic cells, as it…
Q: How will you dilute 100 μl of 25 mg/ml BSA into a final concentration of 2 mg/ml BSA?
A: BSA stands for bovine serum albumin. It has several applications in laboratories. In a microbial…
Q: What is yeast? Why is it a widely used microbe in food industrial microbiology? What characteristics…
A: "Since you have asked multiple questions, we will solve the some question for you. If you want any…
- In your own words, restate the three tenets of cell theory
- Describe the distinctive properties of the four major classes of carbon-based macromolecules: lipids, carbohydrates, amino acids, and
nucleotides. In your response, provide at least one example of each. (2 points)
- Describe the roles of the following in
DNA Replication: primase, helicase, DNA polymerase, ligase, Okazaki fragments
Step by step
Solved in 2 steps
- Explain the complexities of DNA replication that make the process (a) bidirectional and (b) continuous in one strand and discontinuous in the other.Two important proteins in DNA replication are (select two): Cdx2 Cdt2 Cdc6 Cdc6 Cdt1 Cdc5(a) What is the function of helicase in DNA replication?(b) What is the function of DNA polymerase?(c) What are replication forks? Compare and contrast leading and lagging strands. Answer all please
- Name the three major assumptions made by the "Cell theory". (i) The lipid membrane is composed of lipid molecules. Explain the principle of membrane formation highlighting the role of the physical properties of the lipids. (ii) Comparing dimensions and length scales is often a first step in an analysis. Give an approximate value for the thickness of a lipid bilayer and the linear length of a helical turn of a DNA double helix.Explain in your own words why DNA replication issaid to be “semiconservative”?DNA replication is vital for successful cell division. Explain the process of DNA replication. Make sure to use the following terms: helicase, S-phase, DNA polymerase and DNA ligase, template, free nucleotides. Use the diagram if it helps you illustrate your points.
- Why is DNA replication called semiconservative?How does DNA replication occur in a precise manner to ensure that identical genetic information is put into the new chromatid? See Figures 8.12 and 8.13. FIGURE 8.12 In DNA replication, the two polynucleotide strands uncoil, and each is a template for synthesizing a new strand. A replicated DNA molecule contains one new strand and one old strand. This mechanism is called semiconservative replication. FIGURE 8.13 A close-up look at the process of DNA replication. (a) As the strands uncoil, bases are added to the newly synthesized strand by complementary base pairing with bases in the template strand. The new bases are linked together by DNA polymerase. (b) DNA synthesis can proceed only in the 5 3 direction; newly synthesized DNA on one template strand is made in short segments and linked together by the enzyme DNA ligase.Which of the following statements are TRUE?I. DNA replication is a semiconservative process wherein the two resulting double helices consist of one new strand and one parental strand.II. The DNA strand that is used to make a complementary daughter strand is called the parental strand.III. The precursor of each new nucleotide in the DNA strand is a deoxynucleoside 3′-triphosphate.IV. The incoming nucleotide always attaches to 5′-phosphate of the previously added nucleotide
- Which of the following statements are TRUE?I. DNA replication is a semiconservative process wherein the two resulting double helices consist of one new strand and one parental strand.II. The DNA strand that is used to make a complementary daughter strand is called the parental strand.III. The precursor of each new nucleotide in the DNA strand is a deoxynucleoside 3′-triphosphate.IV. The incoming nucleotide always attaches to 5′-phosphate of the previously added nucleotide a. I only b. II only c. I and IV d. III and IVWhich of the following is not a reason why proteins were thought to be the cell's carrier of genetic information? Group of answer choices (A) The genetic information was known to be contained in chromosomes (which consist of DNA and proteins). (B) Protein synthesis only requires proteins. (C) DNA was too simple (D) All of the above support the idea that proteins could be the genetic information.Determine whether the following statement regarding eukaryotic DNA replication is true or false: DNA is linear?
