Concept explainers
To explain: The benefits of new information on the extent of genetic polymorphism among humans, particularly with respect to single-
Introduction: Variation that takes place in a single nucleotide in the genome can be termed as single-nucleotide polymorphism. The change in a single nucleotide can result in the development of diseases like sickle cell anaemia, cystic fibrosis, and so on. Copy number variation is the repetition of part of a genome.
To explain: The challenges of new information on the extent of genetic polymorphism among humans, particularly with respect to single-nucleotide polymorphism and copy number variation.
Introduction: Variation that takes place in a single nucleotide in the genome can be termed as single-nucleotide polymorphism. The change in a single nucleotide can result in the development of diseases like sickle cell anaemia, cystic fibrosis, and so on. Copy number variation is the repetition of part of a genome.
Want to see the full answer?
Check out a sample textbook solutionChapter 19 Solutions
Biology (MindTap Course List)
- List some of the effects and practical applications of molecular genetic analyses.arrow_forwardDo you think an unintended consequence of genetic testing could be that people would be less liable to seek medical care out of fear that they could later be denied life or health insurance? What laws should be used to govern the use of genetic data of this type?arrow_forwardDNA profiling has been used to verify pedigrees of valuable animals such as show dogs, racing greyhounds, and thoroughbred horses. However, the technology is much harder to apply in these cases than it is in forensic applications for humans. In particular, many more DNA markers must be examined in domesticated animals to stablish the identity or close familial relationship of two DNA samples. Why would you need to look at more polymorphic loci in these animals than you would in humans?arrow_forward
- Genomic genealogy websites and services are becoming very popular. Recently a genealogy site was used by the police to identify a candidate for a cold case serial killer. Explain how genealogy can be a powerful tool in such cases. Do you see any ethical issues with the process?arrow_forwardMolecular geneticists interested in the evolutionary history of the human race have concentrated their research on samples of DNA from women representing all races and continents. Why might the DNA of women--and not men--be of interest?arrow_forwardGive typing answer with explanation and conclusion If you want to identify genes linked to autism in a mouse model, which genetic approach or approaches could you use? (Mark all that apply) A) Reverse Genetics B) Forward Genetics C) Optogenetics D) Population Geneticsarrow_forward
- a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forwardShould access and use of Genetic Data be regulated? Weigh both sides of the issue. Who will benefit from the sharing of Genetic Data? Will anyone suffer? Do some arguments outweigh others? If so which ones? Explain your answer.arrow_forwardScientific studies have shown that the majority of human genetic differences worldwide exist within groups (or races) rather than between groups. True or false?arrow_forward
- How does molecular biology paved way for the development of the DNA fingerprinting technique? and what is its molecular basis?arrow_forwardList five reasons why genetic maps are useful?arrow_forwardDescribe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)arrow_forward
- Biology (MindTap Course List)BiologyISBN:9781337392938Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. BergPublisher:Cengage Learning