These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)?     YNENGTITDAVDCALDPLSETK     VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK     RVQPTESIV

Q: ATCGCGCTAGGCGCATGCTACCTAGGCTATCTGCCTAGCTATCGACTAATCTGATCGAGTCAG3’…

A: RNA is formed from DNA by the process of transcription. Amino acids are formed from RNA by the…

Q: Transferring of the protein bands from the SDS-PAGE gel to the PDVF membrane can be troublesome and…

A: Western blot: The technique is used for detecting specific proteins separated by electrophoresis by…

Q: Obj 29. Identify the specific terms applied to the process of protein synthesis described by each…

A: Epinephrine, also known as adrenaline, is a hormone and neurotransmitter that plays a critical role…

Q: Which of these epigenetic changes could lead to reduced transcriptlon gene? Please make sure to…

A: Epigenetics is the study of changes in organisms produced by changes in gene expression rather than…

Q: An important mechanism for generating diversity in immunoglobulin light chain V-region sequences is…

A: The mechanism of gene recombination that occurs during B cell formation allows for the creation of…

Q: Consider the Rho-dependent terminator sequence 5’CCCAGCCCGCCUAAUGAGCGGCCUUUUUUUU-3’. What affect…

A: The mutation is the change in the nucleotide sequence of the DNA. The point mutation is the mutation…

Q: A hypothetical protein found in humans, chimpanzees, and orangutans has the following sequences.…

A: Dashes '-' show sequence deletions; underlined variations 'Y' and 'K' between the species indicate…

Q: What are the functional consequences of this deletion for lilP mRNA transcription and translation?…

A: Introduction :- A deletion mutation is a type of genetic mutation that involves the loss of one or…

Q: VA << < B C Match each letter (A through G) to its description. VD VE VF VG H MAX 20 E A மன்மமும் H…

A: In cell signalling the major substances that involve in signalling cascade are receptor proteins,…

Q: How much more does cytokine 2 gene expression change in severe COVID-19 patients than in mild…

A: Cytokine storm is the condition when various cytokines are expressed in very high levels. This cause…

Q: Trinucleotide repeat expansions (TNREs) are associated with severaldifferent human inherited…

A: The trinucleotide repeat expansion is also called triplet repeat expansion. It is a DNA mutation and…

Q: A C mRNA (Met Gly F GGG AUGCCCACG UAG Which letter indicates the amino end of the growing…

A: A covalent link known as a peptide bond connects the carboxyl group (-COOH) of one amino acid to the…

Q: Why is the peptide formation always presented/read from N-terminal to C-terminal?

A: Introduction:  Amino acids are joined together by a condensation reaction between carboxylic and…

Q: 24

A: GWAS is genome wide association study. The GWAS studies helps to identify genes association with a…

Q: YFP-SC35 encodes a splicing factor. You would expect this molecule to be localized in what…

A: The process of transcription occurs in the nucleus. By this process, mRNA gets synthesized from the…

Q: High salt concentrations tend to cause protein aggregation. Suggest a way to identify proteins…

A: Introduction: Small, microscopic organisms are well-defined and usually described as known as…

Q: Cys-His-Glu-Met-Ile-Ser-Thr-Arg-Tyr

A: Peptides are organic compounds made up of amino acids connected by peptide bonds. The specific…

Q: diagram of the chain of infection for COVID-19

A: The chain of infection shows how the infection (COVID-19) transmits. This chain gives an idea to…

Q: Which set of fragment ions is likely from the same population of precursors ions (parent peptide)…

A: ANS:- None of the described choices are likely.

Q: egions сар, S protein_mut, 3'-UTR, poly (A) tail etc) and why are they included in the MRNA?…

A: mRNA : It is a single stranded molecule of RNA which corresponds to the genetic sequence of a gene…

Q: What do these data say about the requirements for v-SNARES and t-SNARES in the fusion of vacuolar…

A: As mentioned SNARES are important for membrane fusion of vesicles. v SNARES and t SNARES are…

Q: The protein encoded by the cystic fibrosis gene is 1480amino acids long, yet the gene spans 250 kb.…

A: Because the gene contains introns (non-coding regions within the gene) that are removed during the…

Q: Antibodies that bind with high affinity to some viral surface proteins require heavy chain CDR3…

A: Introduction: An antibody is a glycoprotein produced by the plasma cells in response to an allergen…

Q: What amino acid residues are phosphorylated on the intracellular domain of a VEGFR? Glutamic Acid…

A: VEGFR: VEGF receptors are vascular endothelial growth factor receptors (VEGF). VEGFR is divided into…

Q: A) Tet-Off B) Tet-On rRTA ITA TRE Target Transgone TRE Target Transgene +Dox +Tc or +Dox tTA ETA TRE…

A: as the diagram shows the tet-on and tet-off system

Q: The genome of SARS-CoV-2 is a single-stranded sense (coding) mRNA that is translated into many…

A: The three prime untranslated region is abbreviated as 3'UTR. It is the part of messenger RNA that…

Q: function of a Src homology-3 (SH3) domain?

A: Amino acids can be defined as the building blocks that form polypeptides and ultimately proteins.…

Q: please help explain Influenza A virus M2 protein triggers mitochondrial DNA-mediated antiviral…

A: This passage delves into a study that reveals captivating bits of knowledge with respect to the…

Q: Based on the BLASTp and Reciprocal hit analysis is mus musculus a true ortholog for the human fgfr3…

A: Ortholog genes are those genes which are present in different species but have a common ancestor.…

Q: b. Which one of the following a cell mutants will be able to switch at least once? [Select]

A: Alpha (α) thalassemia is a genetic problem and is brought about by cancellations or transformations…

Q: 1 agagtctcct cagacgccga gatgctggtc atggcgcccc gaaccgtcct cctgctgctc 61 tcggcggccc tggccctgac…

A: Annotating a genome involves finding functional components throughout its sequence in order to give…

Q: N' C' = Polypeptide X d a b = SRP 5'- = translocator e Which region(s) of polypeptide X would bind…

A: Ribosomes refer to the site where the protein synthesis takes place. It comprises rRNA and protein.…

Q: Which partial peptide sequence is most likely to be part of a B-turn? O DERKY O LASIK O C VPGE O…

A: Proteins are the polymers of amino acids that of an alpha carbon or chiral carbon having four…

Q: The carboxy terminus of the p53 protein acts as an allosteric regulator of sequence-specific DNA…

A: General structure of p53 protein

Q: What is the utility of understanding the genetic basis of susceptibility to COVID-19 for medicine…

A: To date, 3p21. 31 is the only genetic region significantly associated with severe COVID-19. Having…

Q: Since the query’s are matching does that mean the house mouse( mus musculus) is a good model to test…

A: Thе BLASTP analysis  providеd here dеmonstratеs a high dеgrее of sеquеncе similarity bеtwееn thе…

Q: T7-MDM2 Myc-RYBP p53-(His-Ub), MDM2 p53 Myc-RYBP B-Actin QUESTION 12 In the RYBP case study paper,…

A: *Ring1 and YY1 binding protein (RYBP) belongs to polycomb group proteins that implicated in…

Q: a b A-T (FT169) Vector IR (10 Gy): WT Wortmannin: IR (10 Gy) cap T2609 «DNA-PKcs 1 2 3 1 2 3 4 Ku80…

A: Phosphorylation of a molecule is the process of attachment of phosphoryl group.

Q: If the promoter is here and transcription starts here…

A: Transcription is the process of formation of RNA using DNA as a template.

Q: The anticodon sequence created from the following DNA: TACGGGGCTGAGATT Select one: O a.…

A: The sequence of nucleotides that complement codons is known as an anticodon. They are found in tRNAs…

Q: What is the co-transduction index of histidine and tyrosine, standardized on tyrosine? Recipient…

A: The co-transduction index of histidine and tyrosine, standardized on tyrosine, can be calculated as…

Q: a) Indicate the chronological order the following RNA processing events by indicating a number (from…

A: Step 1 Here's the chronological order of the pre-mRNA processing events: Pre-mRNA processing…

Q: Exon E10 E15 ..... .... RNA (protein) N Give TWO explanations as to how widely separated parts of a…

A: Exon are basically the functional parts of a gene which code for a functional protein. On the other…

Q: he Sequence below comes from the alpha-2 globin of the human hemoglobin gene cluster found in…

A: Given: The sequence of the alpha-2 globin of the human hemoglobin gene cluster found in chromosome…

Q: The Na'vi of Pandora have a neuronal gene (Na'vi) product that undergoes extensive…

A: Transcription occurs in the nucleus. Transcription generates several kinds of RNA from DNA.…