
Human Anatomy & Physiology (11th Edition)
11th Edition
ISBN: 9780134580999
Author: Elaine N. Marieb, Katja N. Hoehn
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Question
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)?
YNENGTITDAVDCALDPLSETK |
||
VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK |
||
RVQPTESIV |
Expert Solution

This question has been solved!
Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.
This is a popular solution
Trending nowThis is a popular solution!
Step by stepSolved in 2 steps

Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- The following truncated sequences are the receptor binding domain of COVID19’s & SARS’ S-protein, COVID19 ATRFAS VYAWNR KRISNC VADYSV LYNASF STFKCY GVSPTK SARS ATKFPS VYAWER KKISNC VADYSV LYNSTF STFKCY GVSATK a) describe the mutations (specify the change that caused SARS’ RNA to evolve into COVID19) b) explain how those changes result in the ability of COVID19 being able to infect human cells (HINT: consider the properties of the amino acids – the R chain)arrow_forwardplease identify amino acids in the N terminus in the picture below.arrow_forwardWhich of the following peptide sequences is most likely to be found in a hydrophobic pocket of the protein containing it DEAD AVGF ACMN GSYKarrow_forward
- 10- 00 O SCNSA-SCN10A CDKN1A HANDI VTI1A SYTI • MYOCD 9 10 11 12 13 14 15 16 17 18 19 20 2122 X Yarrow_forwardThe first thing you'll need to do is annotate the DCR1 gene, as follows: 1 agagtctcct cagacgccga gatgctggtc atggcgcccc gaaccgtcct cctgctgctc 61 tcggcggccc tggccctgac cgagacctgg gccggtgagt gcgggtcggg agggaaatgg 121 cctctgccgg gaggagcgag gggaccqсag gс¶¶¶¶gcgc atgacctcag gagccgcgcc 181 gggaggaggg tcgggcgggt ctcagcccct cctcaccccc aggctcccac tccatgtggt 241 atttctacac ctccgtgtcc cggcccqgcc gcggggagcc ccgcttcatc tcagtgggct 301 acgtggacga cacccagttc gtgaggttcg acagcgacgc cgcgagtccg agagaggagc 361 cgcgggcgcc gtggatagag caggaggggc cggagtattg ggaccggaac acacagatct 421 acaaggccca ggcacagact gaccgagaga gcctgcggaa cctgcgcttc tactacaacc 481 agagcgaggc cgttgcqtga ccccqgcccg gggcgcaggt cacgactccc catcccccac 541 gtacqgcccg ggtcgccccg agtctccggg tccgagatcc gcctccctga ggccqcggga promoter: nucleotide 1 - 108; highlight in yellow exon #1: nucleotide 109 - 285; highlight in green intron (there is only one intron in this gene); highlight in light grey exon #2: nucleotide 455 - 567; highlight in blue start…arrow_forwardcan u help with this please thank you so mucharrow_forward
- When Zidovudine (3'-azidothymidine or AZT) is added directly to an assay measuring the rate of DNA synthesis catalyzed by the AIDS virus reversed transcriptase, AZT is shown to be without significant inhibitory activity. Explain how AZT is metabolized in virus infected cells to convert the nucleoside into a potent and effective reversed transcriptase inhibitor.arrow_forward11 111 FLATRON WIS songs to listen to on a late n (1) Messenger f 253282375 390061782796379 8 x ++ Scontent.fmnl17-4.fna.fbcdn.net/v/t1.15752-9/253282375 390061782796379 8678836692018933574_n.jpg?_nc_cat3D105&ccb%3D1-5&_nc_sid=Dae9488&_nc_eui2=DAeERUdQ E Apps Discussion Questions (answer these questions on a separate sheet of paper) 1. Explain how hCG secretion is regulated. Is it secreted by a pregnant woman or her offspring? 2. hCG depresses some reactions of the immune system. What adaptive advantage do you think this has? Ac P Type here to search LGarrow_forwardsars-coV-2 spike protien what is the isoelectric point of this peptide? VGIYLQKTSDHRPEFALAMNarrow_forward
- You are studying a caspase cleavage site in an N protein from a new coronavirus you make a D/E site-directed mutation at this cleavage site and find that the Mutant protein is uncleaved during virus-induced apoptosis. Thus the aspartic acid is: a negative regulator of cleavage irrelevant for cleavage necessary for cleavage sufficient for cleavagearrow_forward2010-10194 E / 65029030 + +H OTU Domain What is designated by 'rs'? Please expalin (50 words or less) E3 Igaso Zinc Finger Regionarrow_forwardA synthetic mRNA added to a cell-free protein-synthesizing system produces a peptide with the following amino acid sequence: Met-ProIle-Ser-Ala. What would be the effect on translation if the following component were omitted from the cell-free protein-synthesizing system? What, if any, type of protein would be produced? Explain your reasoning. Q. Elongation factor Tuarrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education

Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON

Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax

Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,

Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company

Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.

Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education