These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)?     YNENGTITDAVDCALDPLSETK     VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK     RVQPTESIV

10- 00 O SCNSA-SCN10A CDKN1A HANDI VTI1A SYTI • MYOCD 9 10 11 12 13 14 15 16 17 18 19 20 2122 X Y

The first thing you'll need to do is annotate the DCR1 gene, as follows: 1 agagtctcct cagacgccga gatgctggtc atggcgcccc gaaccgtcct cctgctgctc 61 tcggcggccc tggccctgac cgagacctgg gccggtgagt gcgggtcggg agggaaatgg 121 cctctgccgg gaggagcgag gggaccqсag gс¶¶¶¶gcgc atgacctcag gagccgcgcc 181 gggaggaggg tcgggcgggt ctcagcccct cctcaccccc aggctcccac tccatgtggt 241 atttctacac ctccgtgtcc cggcccqgcc gcggggagcc ccgcttcatc tcagtgggct 301 acgtggacga cacccagttc gtgaggttcg acagcgacgc cgcgagtccg agagaggagc 361 cgcgggcgcc gtggatagag caggaggggc cggagtattg ggaccggaac acacagatct 421 acaaggccca ggcacagact gaccgagaga gcctgcggaa cctgcgcttc tactacaacc 481 agagcgaggc cgttgcqtga ccccqgcccg gggcgcaggt cacgactccc catcccccac 541 gtacqgcccg ggtcgccccg agtctccggg tccgagatcc gcctccctga ggccqcggga promoter: nucleotide 1 - 108; highlight in yellow exon #1: nucleotide 109 - 285; highlight in green intron (there is only one intron in this gene); highlight in light grey exon #2: nucleotide 455 - 567; highlight in blue start…

can u help with this please thank you so much

When Zidovudine (3'-azidothymidine or AZT) is added directly to an assay measuring the rate of DNA synthesis catalyzed by the AIDS virus reversed transcriptase, AZT is shown to be without significant inhibitory activity. Explain how AZT is metabolized in virus infected cells to convert the nucleoside into a potent and effective reversed transcriptase inhibitor.

11 111 FLATRON WIS songs to listen to on a late n (1) Messenger f 253282375 390061782796379 8 x ++ Scontent.fmnl17-4.fna.fbcdn.net/v/t1.15752-9/253282375 390061782796379 8678836692018933574_n.jpg?_nc_cat3D105&ccb%3D1-5&_nc_sid=Dae9488&_nc_eui2=DAeERUdQ E Apps Discussion Questions (answer these questions on a separate sheet of paper) 1. Explain how hCG secretion is regulated. Is it secreted by a pregnant woman or her offspring? 2. hCG depresses some reactions of the immune system. What adaptive advantage do you think this has? Ac P Type here to search LG

sars-coV-2 spike protien what is the isoelectric point of this peptide? VGIYLQKTSDHRPEFALAMN

You are studying a caspase cleavage site in an N protein from a new coronavirus you make a D/E site-directed mutation at this cleavage site and find that the Mutant protein is uncleaved during virus-induced apoptosis. Thus the aspartic acid is:  a negative regulator of cleavage  irrelevant for cleavage  necessary for cleavage  sufficient for cleavage

2010-10194 E / 65029030 + +H OTU Domain What is designated by 'rs'? Please expalin (50 words or less) E3 Igaso Zinc Finger Region

A synthetic mRNA added to a cell-free protein-synthesizing system produces a peptide with the following amino acid sequence: Met-ProIle-Ser-Ala. What would be the effect on translation if the following component were omitted from the cell-free protein-synthesizing system? What, if any, type of protein would be produced? Explain your reasoning. Q. Elongation factor Tu