The following sequence is part of a globular protein. Predict the secondarystructure in this region.cRRPVVLMAACLRPVVFITYGDGGTYYHWYH c

Q: The amino acid sequence of human vasopressin is Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly. Write an mRNA…

A: The given amino acid sequence of human vasopressin is Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly.  3…

Q: Assume the following portion of an mRNA. Find a start signal, and write the amino acid sequence that…

A: The sequence of protein is usually notated as a string of letters, according to the order of the…

Q: Look at the m-RNA message below: PUT A NUMBER under each of the t-RNA/amino acid complexes to show…

A: DNA( deoxyribonucleic acid) is the double-stranded molecule that is the genetic material in most…

Q: Which peptide sequence is most likely to be found within the inner core of a globular protein?…

A: Biochemistry is a branch of science that deals with the study of chemical processes related to the…

Q: CGA CUA CCA UCA ACA GUA GGA GGC CCGC AUA CUC CCC UCC ACC GUC 3 CGG GAC AAC UGC GAA CAA GGG CAC AUC…

A: The process of synthesis of proteins with the help of messenger RNA is called translation. Proteins…

Q: What MRNA sequence codes the tripeptide shown below (write code in direction of N-terminus to…

A: Peptides are present in all individuals which are living. Peptides play may functional roles in our…

Q: When the voltage gated potassium channel moves from an open to a closed formation the 5th alpha…

A: Biomolecules are the biological molecules that are present inside the living organisms. These…

Q: TACTCACCCCGTATTACGTTT What’s the MRNA Protein Phenotype

A: Transcription is the process which produces mRNA from DNA by the action of RNA polymerase.…

Q: Write the order of nucleotides in mRNA that would be transcribed from the following strand of DNA:…

A: Hi, Thanks For Your Question.  Answer : Let's Learn Some Basic Concepts First: Transcription : It Is…

Q: Protein: Hemoglobin Circle and underline each codon, amino acid sequence, make a mutation of the 3rd…

A: Here the not cleared the mutation type, are point mutations, frame shift mutation, addition mutation…

Q: Sequence: CUCAACACGCCGCUCAGUGCCCUCGUGAUGAAGCAUAGGGGAAAC   By in vitro translating the mRNA, you…

A: DNA and RNA are nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid whereas…

Q: The DNA in the coding strand below contains a short imaginary sequence for a short protein in…

A: DNA sequence: 5'-ATGTACCTCGACGATCAAGGCAA-3'1. m RNA sequence:Due to complementary base pairing rules…

Q: TACTGCCTCCCCATAAGAATT

A: Transcription is the process in which a gene's DNA sequence is copied (transcribed) to make an RNA…

Q: An mRNA may contain the sequence ATTGACCCCGGTCAA True/False

A: RNA or ribonucleic acid is a polymeric molecule essential in various biological roles in coding,…

Q: B. A polypeptide has 51 amino acids in its primary structure. (i) What is the minimum number of DNA…

A: Introduction DNA resides in the sequence of four nucleotides. The genetic code is a triplet code…

Q: The amino acids, in one-letter symbols and no spaces, coded by the following mRNA sequence is 5’…

A:

Q: The transcribed portion of a DNA sequence for a gene is shown below. Identify the MRNA sequence and…

A: The procedure of determining the order of the four nucleotide bases (adenine, thymine, cytosine, and…

Q: Considering the given sequence of nucleotides in an mRNA molecule, (a) what is the sequence of the…

A: Gene expression is the process by which the instructions in the DNA are converted to functional…

Q: Given the following DNA sequence: 3'-TACTTNGTNCTNTCN-5' where N stands for any nucleotide, give the…

A: Introduction The process of duplicating a DNA molecule is known as DNA replication. When a cell…

Q: Fill in the complementary DNA strands for the DNA strands below Which nitrogen base CAN'T you use…

A: DNA( deoxyribonucleic acid) is the double-stranded molecule that is the genetic material in most…

Q: If my final mRNA product sequence is this: CAAGAUGUACUUUGCGACAAGAGAGGAUCCCAUCUGUGCGACUUGAACG What…

A: The central dogma of life states that there is a unidirectional flow of information from master copy…

Q: What side group reacts with this reducing agent? What does the fact that these peptides both react…

A: There are four levels of protein structure hierarchy: Primary structure, Secondary structure,…

Q: A transmembrane protein is positioned such that the N-terminus and C-terminus are directed towards…

A: Based on the property of amino acids they found in the intracellular and extracellular environment.

Q: Identify the polar and nonpolar parts of the assembly. Identify the pocket and the two bilayers that…

A: Polar components are those that are hydrophilic and soluble in water. Non polar components are those…

Q: Complete the protein synthesis for the partial DNA sequence for a normal FGFR3 gene (TOP) and…

A: FGF3 gene is responsible for producing a protein called fibroblast growth factor 3 which is a part…

Q: Translation of mRNA Using the codon chart provided, translate the following messenger RNA sequence…

A:

Q: Provide the abbreviation for the amino acid sequence expected from the following MRNA segment using…

A: Following amino acid sequence is predicted.

Q: Sequence: AAA UGG CAA Translate the sequence into the correct amino acids.   Question 2 options:…

A:

Q: Define upstream processing when producing a protein and list two examples. Cite it.

A: A bioprocess is a method for producing desirable products having medicinal importance with the help…

Q: 4. Sickle cell anemia occurs due to a point mutation in a gene for hemoglobin protein. This mutation…

A: Introduction : In sickle cell anemia, there is single nucleotide change within the gene. Thymine…

Q: The folding of some protein was monitored as a function of the time it takes for the protein to…

A: The proteins can be modified by different modifications and this modification can affect the…

Q: Consider the mRNA sequence below. Assume that the following mRNA segment has been translated.…

A: Francis crick proposed the central dogma, which states that the DNA is replicated. This DNA is used…

Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…

A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…

Q: Write the amino acid sequence based on the following portion of MRNA. Write the name of the amino…

A: The codons which are present on mRNA are will code for specific amino acids based on genetic code…

Q: In relation to the peptide sequence that is presented. -Gly - Ser – Cys – Asp – Glu – Arg – Cys –…

A: The given peptide sequence contains 8 amino acids. In a peptide, individual amino acids are joined…

Q: (b) Hemoglobin is made of B-globin subunits. The first few mRNA nucleotides for B- globin are given…

A: RNA strnad given = 5'-AUGGUCCACCUGACUCCUGAGGAGAAG...UGA-3' (i) DNA strand from which this mRNA is…

Q: Determine which amino acid is formed from the following mRNA codon: GUA.     a aspartic acid b…

A: Introduction :- Amino acids are the building blocks of proteins. The building blocks of life are…

Q: Which of the following peptide sequences is most likely to be found in a hydrophobic pocket of the…

A: Introduction: The correct choice is option 2. AVGF

Q: Label the following diagram

A: Eukaryotic pre mRNA undergo various modifications to become a functional mRNA in cell. It includes…

Q: Lactose Permease is roughly 45 kDa in size. Approximately how many nucleotides in length is the…

A: Lactose permease is a membrane protein serving as a transport system for lactose into the E. coli…

Q: Identify the features of tRNA that are important in decoding genetic information and converting it…

A: Codons encode specific amino acids for protein synthesis, a process known as translation. Transfer…

Q: GGGAGTGTATACGGGATGAAGGCATT MRNA: Protein And the phenotype?

A: Proteins are translated from mRNA which result into specific functions or phenotypes.

Q: The following segment of DNA codes a protein. The uppercase letters represent Exons, the lowercase…

A: DNA and RNA are the biomolecules that make up the part of our genetic material. DNA is the genetic…

Q: Amino Acid Sequence: LEU-ISO-PRO-PRO-PHE-ILE-LEU-LEU-SER-HIS-LEU-LEU-SER DNA Sequence:…

A: Closer the DNA constitution of organisms closer are they in their protein content. One can determine…

Q: If the mRNA sequence is ATG GGG AGC What is the anticodon sequence?

A: To find the anticodon sequence for the given mRNA sequence "AUG GGG AGC", we need to complement the…

Process Flow Diagram

A process flow diagram is a representation of various components, how they are arranged, and in what manner or sequence they work in correspondence to each other. It is a graphical way of representing a process.