Using the following sequence and the amino acid chart, please give the amino acid sequence: 5'-UCAGAUGGGAAGCUUGAUCUUGUGA-3'. Abreviations for the amino acids are accepted.

Use the following DNA sequence, and write the resulting messenger RNA sequence TACTTTGAATGCGGCCGTATC?

How do you translate this into amino acid sequence  UGUCAUGCUCGUCUUGAAUCUUGUGAUGCUCGUUGGAUUAAUUGU

Write the complementary sequence for the following DNA sequence, in order from 3' to 5': 5′−CGATATTGAGCTAAGCTT−3′

Name each amino acid below with only their full name and the three-lever abbreviation. Submit your answer by whung the amino acid next to the corresponding letter. (Note: all amino acids must be named and spelled correct to be awarded as a correct answer) A) B) HN-CH-ċ- -OH HN-CH -č -HO- CH2 CH2 OH CH2 CH2 NH2 HN NH CENH NH2 D) H-N-CH-C-OH E) CH2 HN-CH- -OH CH-CH3 CH3 HN

1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…

Enumerate all the possible DNA nucleotide base sequence for the amino acids given.

How do the "R" groups of amino acids contribute to the 3-D shape?

Finally, the researcher incubates the peptide with chymotrypsin for two hours at 10 °C and analyzes the products using chromatography. Complete chymotryptic digestion of the peptide with chymotrypsin followed by chromatography yields free tyrosine and free leucine, plus a tripeptide containing Phe and Gly in a 1:2 ratio. Give the final sequence for the peptide based on the results of the acid hydrolysis, dansyl chloride reaction, and chymotryptic digestion. Use the three-letter amino acid abbreviations separated by hyphens for your answer. peptide sequence:

с" CH2 CH2 "НaN H с. CH С" CH Нзс CHз ZI о-о