Concepts of Genetics (12th Edition)
12th Edition
ISBN: 9780134604718
Author: William S. Klug, Michael R. Cummings, Charlotte A. Spencer, Michael A. Palladino, Darrell Killian
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 5, Problem 24PDQ
Traditional gene mapping has been applied successfully to a variety of organisms including yeast,
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solution
Students have asked these similar questions
Northern blotting, RT-PCR, and microarrays can be used to analyze gene expression. A lab studies yeast cells, comparing their growth in two different sugars, glucose and galactose. One student is comparing expression of the gene HMG2 under these two conditions. Which technique(s) could he use and why? Another student wants to compare expression of all the genes on chromosome 4, of which there are approximately 800. What technique(s) could she use and why?
When the S.cerevisiae genome was sequenced and surveyed for possible genes, only about 40% of those genes had been previously identified in forward genetic screens. This left about 60% of predcited genes with no known function, leading some to dub the genes fun (function unknown) genes.
a)As an approach to understanding the function of a certain fun gene, you wish to create a loss of function allele. How would you do this?
b)You wish to know the physical location of the encoded protein product. How would you obtain such information?
In contrast with the genomic manipulations of animals and plants described in this chapter, human genetherapy is directed specifically at altering the genomes of somatic cells rather than germ-line cells.Why couldn’t or wouldn’t medical scientists try to alter the genome of human germ-line cells?
Chapter 5 Solutions
Concepts of Genetics (12th Edition)
Ch. 5 - In a family with one autistic child the risk for...Ch. 5 - Given that the prenatal test can provide only a...Ch. 5 - Consider two hypothetical recessive autosomal...Ch. 5 - With two pairs of genes involved (P/p and Z/z), a...Ch. 5 - In Drosophila, a heterozygous female for the...Ch. 5 - HOW DO WE KNOW? In this chapter, we focused on...Ch. 5 - Review the Chapter Concepts list on page 94. Most...Ch. 5 - Describe the cytological observation that suggests...Ch. 5 - Why does more crossing over occur between two...Ch. 5 - Explain why a 50 percent recovery of...
Ch. 5 - Why are double-crossover events expected less...Ch. 5 - What is the proposed basis for positive...Ch. 5 - What two essential criteria must be met in order...Ch. 5 - The genes dumpy (dp), clot (cl), and apterous (ap)...Ch. 5 - Colored aleurone in the kernels of com is due to...Ch. 5 - In the cross shown here, involving two linked...Ch. 5 - In a series of two-point mapping crosses involving...Ch. 5 - Two different female Drosophila were isolated,...Ch. 5 - In Drosophila, a cross was made between femalesall...Ch. 5 - Another cross in Drosophila involved the...Ch. 5 - In Drosophila, Dichaete (D) is a mutation on...Ch. 5 - Drosophila females homozygous for the third...Ch. 5 - In Drosophila, two mutations, Stubble (Sb) and...Ch. 5 - If the cross described in Problem 18 were made,...Ch. 5 - Are mitotic recombinations and sister chromatid...Ch. 5 - What possible conclusions can be drawn from the...Ch. 5 - An organism of the genotype AaBbCc was testcrossed...Ch. 5 - Based on our discussion of the potential...Ch. 5 - Traditional gene mapping has been applied...Ch. 5 - DNA markers have greatly enhanced the mapping of...Ch. 5 - In a certain plant, fruit is either red or yellow,...Ch. 5 - Two plants in a cross were each heterozygous for...Ch. 5 - A number of humanmouse somatic cell hybrid clones...Ch. 5 - A female of genotype produces 100 meiotic tetrads....Ch. 5 - In laboratory class, a genetics student was...Ch. 5 - Drosophila melanogaster has one pair of sex...Ch. 5 - In Drosophila, a female fly is heterozygous for...Ch. 5 - The gene controlling the Xg blood group alleles...Ch. 5 - Prob. 34ESP
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Should the exposome field focus exclusively on measuring chemicals derived from exogebeous sources or should the field also evaluate the chemicals generated and processed from endogeneous sources? If a study of the human genome gave rise to genomics, does the human exposome give rise to a new field of exposomics?arrow_forwardDo all of them True/False 31) The process by which an electrical charge is used to introduce DNA into a cell to produce a transgenic organism is called electroporation.Answer: 32) Reproductive cloning is used to produce large amounts of mammalian proteins from transgenic agricultural animals such as cattle.Answer: 33) In gene addition, homologous recombination is used to remove the original gene and replace it with the cloned gene.Answer: 34) All stem cells have the potential to differentiateAnswer: 35) A bone marrow transplant involves the transfer of multipotent stem cellsAnswer: 36) The fact that in mammalian systems multiple genes may compensate for the loss of a gene is called gene redundancy.Answer:arrow_forwardCommon bean (Phaseolus vulgaris L.) is a legume deficient of an essential amino acid methionine while wheat (Triticum aestivum) is rich in lysine. Common bean crop needs to be fortified for nutritional improvement using genetic engineering. What could be the best transformation method for transfer of that particular set of genes in to common bean genome. Elaborate some conventional and non-conventional methods that could be usedarrow_forward
- DNA markers have greatly enhanced the mapping of genes in humans. What are DNA markers, and what advantage do they confer?arrow_forwardMost organisms display a circadian rhythm, a cycling of biological processes that is roughly synchronized with day length. In Drosophila, pupae eclose (emerge as adults after metamorphosis) at dawn. a)Using this knowledge how would screen for Drosophila mutants that have an impaired circadian rhythm? b)In each case, how would you clone the genes you identified by mutation?arrow_forwarda) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSParrow_forward
- You just graduated from college and started working at a biotech startup called Scrofabulous. Your first job assignment is to clone the pig gene for the hormone prolactin. Assume that the pig gene for prolactin has not yet been isolated, sequenced, or mapped; What would be the most useful and economical first step to go about identifying and cloning the pig gene for prolactin? use the amino acid sequence of mouse prolactin to design a pair of degenerate oligonucleotide PCR primers to PCR-amplify the pig prolactin gene. RNAseq the pituitary gland of the pig, the most abundant gene is likely to to be prolactin Conduct a proteome search for peptides that match parts of mouse prolactin protein Sequence the pig genome, then translate the genome to find the gene predicted to encode for prolactin Crystalize the mouse prolactin protein and use Google's DeepMind Al to find the closest amino acid sequence in the pig proteomearrow_forwardWhat are site-recombinases? Describe in detail how cre- recombinase can be used to decipher the roles of specific genes and proteins in complex multicellular organisms? Explain how the cre-lox system can be used to examine the role of a particular gene in a specific type of tissue?arrow_forwardWith the many high throughput experiments that are used in biomedical research, how are some ways to integrate those datasets using systems biology? For example, if you had a microarray dataset that annotated gene expression levels and a proteomics dataset that identifed protein interactions, how could you jointly use both datasets to identify markers for a disease? Explain each step.arrow_forward
- What are some possible research questions and practical applications that could be addressed by creating organisms with artificial chromosomes and synthetic genomes? What might be some potential safety, environmental, social, and ethical concerns about creating organisms with synthetic genomes?arrow_forwardScientists carried out a microarray analysis to compare the gene expression of normal pancreatic cells to that of cancer cells from a person with pancreatic cancer. The scientists labeled the cDNA from the normal pancreatic cells with green fluorescent nucleotides. They labeled the cDNA from the cancer cells with red fluorescent nucleotides. The two cDNAs were mixed and allowed to hybridize to a microarray. Less p53 activity is found in cancer pancreatic cells than normal cells. What color would the spot for the p53 gene be on the microarray? Red Green Yellow Blackarrow_forwardMutations in the CFTR gene result in cystic fibrosis in humans, a conditions in which abnormal secretions are present in the lungs, pancreas, and sweat glands. The gene was mapped to a 500-kb region on chromosome 7 containing 3 candidate genes. a)Using your knowledge of the disease symptoms, how would you distinguish between the candidate genes to decide which is most likely to encode the CFTR gene? b)How would you prove that your chosen candidate is the CFTR gene?arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSON
Biology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStax
Anatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education
Molecular Techniques: Basic Concepts; Author: Dr. A's Clinical Lab Videos;https://www.youtube.com/watch?v=7HFHZy8h6z0;License: Standard Youtube License