Becker's World of the Cell (9th Edition)
9th Edition
ISBN: 9780321934925
Author: Jeff Hardin, Gregory Paul Bertoni
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Question
Chapter 3, Problem 3.1CC
Summary Introduction
To determine: The effect on all three higher levels of proteins (secondary, tertiary, and quaternary) if three amino acids are missing in the primary sequence causing a condition of anemia.
Introduction: The shape and structure of a protein can be determined by four levels of the organization- primary, secondary, tertiary, and quaternary. Primary structure may be defined as the sequence of amino acids whereas all the three higher levels of structures (secondary, tertiary, and quaternary) are produced from the interaction between amino acids residues.
Expert Solution & Answer
Want to see the full answer?
Check out a sample textbook solutionStudents have asked these similar questions
Patients suffering from sickle cell anemia have a mutation in the gene that codes for one of the hemoglobin chains, in which a single glutamate is replaced by a valine.
Propose an explanation for why this substitution has such a striking effect on protein structure and function with explanation.
Suggest two other amino acids that would be less likely to cause such serious impairment of hemoglobin function if each was substituted for glutamate. Briefly explain your answer.
Are proteins with the same number of each different amino acid that form them necessarily identical proteins?
Protein structure is determined solely by a protein’s amino acid sequence. Should a genetically engineered protein in which the original order of all amino acids is reversed have the same structure as the original protein?
Chapter 3 Solutions
Becker's World of the Cell (9th Edition)
Ch. 3 - What structural features of protein molecules...Ch. 3 - Prob. 3.1CCCh. 3 - Like proteins, nucleotides are important...Ch. 3 - Polysaccharides are also important macromolecules...Ch. 3 - Prob. 3.4CCCh. 3 - Polymers and Their Properties. For each of the six...Ch. 3 - Stability of Protein Structure. Several different...Ch. 3 - Prob. 3.3PSCh. 3 - Prob. 3.4PSCh. 3 - Hair Versus Silk. The a-keratin of human hair is a...
Ch. 3 - The Permanent Wave That Isnt. The permanent wave...Ch. 3 - Features of Nucleic Acids. For each of the...Ch. 3 - Wrong Again. For each of the following false...Ch. 3 - Prob. 3.9PSCh. 3 - Prob. 3.10PSCh. 3 - Telling Them Apart. For each of the following...Ch. 3 - Prob. 3.12PSCh. 3 - Prob. 3.13PSCh. 3 - QUANTITATIVE Thinking About Lipids. You should be...Ch. 3 - Shortening. A popular brand of shortening has a...
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Similar questions
- Red blood cells are normally circular in shape. Sickle cell anemia is a disorder that affects the shapes red blood cells causing them to be sickleshaped (like a crescent moon). Beta hemoglobin normally consists of a chain of 147 amino acids (441 base pairs of DNA). In patients with sickle cell anemia, the beta hemoglobin still has 147 amino acids, yet one amino acid is different. The table below shows a section of the amino acid sequence : Based on the data provided of amino acid sequences and the shape difference between normal red blood cells and those with the sickle cell mutation , which of the following interpretations of data best explains these differences?arrow_forwardWhen an inappropriate amino acid is substituted in place of another, as occurs in certain genetic disorders, the resulting protein is either poorly functional or non-functional. Since proteins contain hundreds if not thousands of amino acids, why should the change of a single amino acid be so critical?arrow_forwardIs it expected that a change in the primary, in the secondary or in the tertiary structure of a protein will produce more functional consequences?arrow_forward
- Consider the following in light of the concept of levels of structure (primary, secondary, tertiary, quaternary) as defined for proteins. (a) What level is shown by doublestranded DNA? (b) What level is shown by tRNA? (c) What level is shown by mRNA?arrow_forwardWhich of the following amino acids is most likely to be found on the outside of a soluble protein, and which of them is more likely to be found on the inside? Explain each answer. (Hint: Consider the effect of the amino acidside chain in each case and that the protein is folded up into its globular form.)(a) Valine (b) Aspartate(c) Histidine (d) Alaninearrow_forwardAmino acids project from each polypeptide backbone in a β-sheet in an alternating fashion (oneabove the plane and the next below the plane – see Fig 3.8B). Consider the following proteinsequence: Leu-Lys-Val-Asp-Ile-Ser-Leu-Arg-Leu-Lys-Ile-Arg-Phe-Glu.a. Is there a pattern to these amino acids? If so, what is it? b. What does this sequence of amino acids mean for the hydrophobicity/hydrophilicity of theresulting β-sheet? c. Can you make a prediction about how the β-sheet will be arranged in higher levels of protein structure? If so, what prediction would you make?arrow_forward
- What is the Three-Dimensional Structure of a Protein’s Amino Acid Sequence Dictates?arrow_forwardConsider the following in light of the concept of levels of structure (primary, secondary, tertiary, quaternary)as defined for proteins.(a) What level is shown by double-stranded DNA?(b) What level is shown by tRNA?(c) What level is shown by mRNA?arrow_forwardHOW MANY DIFFERENT PROTEINS CAN BE CONSTRUCTED THAT ARE EXACTLY FOUR AMINO ACIDS LONG? (HINT: THERE ARE 20 POSSIBLE AMINO ACIDS.)arrow_forward
- Can you please identify what type of protein this is?arrow_forwardThe affinity of hemoglobin for oxygen varies according to the pH of the plasma. In fact, the warmer and more acidic your blood is, the more likely it is that hemoglobin will let go of oxygen. Explain, in terms of the secondary and tertiary structure of protein why this would be so.arrow_forwardThe following sequence is part of a globular protein. Predict the secondary structure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ..arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
- Human Anatomy & Physiology (11th Edition)BiologyISBN:9780134580999Author:Elaine N. Marieb, Katja N. HoehnPublisher:PEARSONBiology 2eBiologyISBN:9781947172517Author:Matthew Douglas, Jung Choi, Mary Ann ClarkPublisher:OpenStaxAnatomy & PhysiologyBiologyISBN:9781259398629Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa StouterPublisher:Mcgraw Hill Education,
- Molecular Biology of the Cell (Sixth Edition)BiologyISBN:9780815344322Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter WalterPublisher:W. W. Norton & CompanyLaboratory Manual For Human Anatomy & PhysiologyBiologyISBN:9781260159363Author:Martin, Terry R., Prentice-craver, CynthiaPublisher:McGraw-Hill Publishing Co.Inquiry Into Life (16th Edition)BiologyISBN:9781260231700Author:Sylvia S. Mader, Michael WindelspechtPublisher:McGraw Hill Education
Human Anatomy & Physiology (11th Edition)
Biology
ISBN:9780134580999
Author:Elaine N. Marieb, Katja N. Hoehn
Publisher:PEARSON
Biology 2e
Biology
ISBN:9781947172517
Author:Matthew Douglas, Jung Choi, Mary Ann Clark
Publisher:OpenStax
Anatomy & Physiology
Biology
ISBN:9781259398629
Author:McKinley, Michael P., O'loughlin, Valerie Dean, Bidle, Theresa Stouter
Publisher:Mcgraw Hill Education,
Molecular Biology of the Cell (Sixth Edition)
Biology
ISBN:9780815344322
Author:Bruce Alberts, Alexander D. Johnson, Julian Lewis, David Morgan, Martin Raff, Keith Roberts, Peter Walter
Publisher:W. W. Norton & Company
Laboratory Manual For Human Anatomy & Physiology
Biology
ISBN:9781260159363
Author:Martin, Terry R., Prentice-craver, Cynthia
Publisher:McGraw-Hill Publishing Co.
Inquiry Into Life (16th Edition)
Biology
ISBN:9781260231700
Author:Sylvia S. Mader, Michael Windelspecht
Publisher:McGraw Hill Education