Which two species in this DNA sequence alignment are the most closely related? Explain your answer referring to specific nucleotide positions to justify the choice you made. Sites in DNA Sequence Species 1 2 3 4 5 7 A G C A G T II G G A A G II A C A C T G А A G G A G

Which two species in this DNA sequence alignment are the most closely related? Explain your answer referring to specific nucleotide positions to justify the choice you made. Sites in DNA Sequence Species 1 2 3 4 5 7 A G C A G T II G G A A G II A C A C T G А A G G A G

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter19: Genomes And Proteomes

Section: Chapter Questions

Problem 1ITD: Below is a sequence of 540 bases from a genome. What information would you use to find the...

See similar textbooks

Related questions

Q: G C T A T A A T G G C A a a a t t g G G T C A G G C A a a t c g a C A T A G C T G A C G G g g a t g…

A: Dna is read in 5 ' to 3 ' direction and the mrna is read by the trna in the form of genetic code by…

Q: Chargaff's analysis of the relative base composition of DNA was significant because he was able to…

A: Introduction DNA is a polymer made up of two polynucleotide chains that coil around each other to…

Q: ONA sequences have an alphabet {A, C,G,T}. How many DNA sequences of length n are there? (Two DNA…

A: Dna is a nucleic acid polymer made of deoxyribonucleotides. It is a bit like a string of letters…

Q: Which 2 primers will copy the entire sequence of DNA: 5'…

A: Primer is a short nucleotide sequence which is required to initiate DNA replication . To the primers…

Q: Which pair of sequences demonstrate the strongest case of "excess similarity"? a) Two nucleotide…

A: The nucleotide sequence consists of repetitive nitrogen bases of adenine, thymine, guanine, and…

Q: Draw a double-stranded DNA molecule (using different colors for each) model should clearly represent…

A: A G T A C C G G G C A A the sequence of DNA

Q: AKS 5a: Use the table below to answer the question that follows. Trout are a fish that are closely…

A: DNA( deoxyribonucleic acid) is the double-stranded molecule that is the genetic material in most…

Q: 1. Below is an amino acid sequence for the following strand of DNA: A G C A A T C C G T C T T G G T…

A: Ans 1 : Point mutation

Q: 1) What DNA base sequence is complementary to the following DNA sequence? TAGCGTGCATGGTGCTTAAC 2)…

A: Introduction: DNA stands for 'deoxyribonucleic acid' and it is the hereditary material in humans and…

Q: Consider the following two DNA sequences. What is the genetic distance between them? Species…

A: Genetic variation refers to diversity in gene frequencies. It can refer to differences between…

Q: Organism Tissue % Adenine % Guanine % Cytosine % Thymine Yeast 31.3 18.7 17.1 32.9 Sea…

A: Chargaff’s Rules It was best-known that deoxyribonucleic acid consists of nucleotides, every of that…

Q: Here is a nucleotide sequence: ATGCAAGGTT. Choose the answer that correctly identifies both the type…

A: DNA and RNA are two nucleic acid polymers found in all living cells. Both are made up of nucleotide…

Q: Which one of the following options would be a good way to identify the location of the poly A tail…

A: Pre mRNA undergoes several post-transcriptional modifications. One of these modifications is…

Q: "Chargaff's rules" about the composition of bases in DNA dictates that A. the sum of purine…

A: Chargaff's rules explain the structure and composition of DNA. Chargaff's rules include the…

Q: he DNA of each species has a different base composition. Find the base composition of each species,…

A: Introduction Adenine, Guanine, Thymine, and Cytosine are the only nucleotides that may exist in DNA;…

Q: Chargaff's Rule implies the percentage of adenine-thymine pairs and the percentage of…

A: The nucleic acid DNA is composed of 4 types of nucleotides - Adenine (A), Guanine (G), Thymine (T),…

Q: What are the component parts of a single DNA nucleotide? Group of answer choices A)a pentose…

A: Answer : Options A is correct :

Q: A linear piece of DNA was broken into random, overlapping fragments and each fragment was sequenced.…

A: An overlapping gene fragment is a gene whose nucleotide sequence partially overlaps with that of…

Q: Which of the following best explains the production of Okazaki fragments in replicating DNA (a) DNA…

A: Okazaki fragments also known as lagging strand in DNA replication is a strand whose RNA primers are…

Q: a) Explain how the sea urchin and salmon data demonstrate both of Chargaff's rules Using Chargaff's…

A: Chagaff's rule states that in genetic material (DNA) of any organism, Purines should be equal to…

Q: If 17% of the nitrogenous bases in a sample of DNA from a particular organism are cytosine, what…

A: Introduction: DNA, or deoxyribonucleic acid, is the hereditary material in humans and nearly all…

Q: For the DNA structure below write the correct base sequence in the form: 5-АТСТ-3 3'-TAGA-5 Make…

A: DNA or deoxyribonucleotide is the genetic material that is present in the higher organisms like…

Q: has a genetic code similar to organisms of Earth, except that there are three different nitrogenous…

Q: Corn_AA DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 16 :: Figure: Sequence alignment…

A: Sequence alignment is defined as the arrangement of sequences of DNA, RNA, proteins to identify…

Q: A-DNA is a double-stranded form of DNA that has a helical radius and helical pitch compared to the…

A: Biological macromolecules are those large molecules that are necessary for the survival and growth…

Q: You analyse some DNA using an automated sequence reaction. The first peak you observe is labeled…

A: Given: You analyse some DNA using an automated seqyence reaction. The first peak you observe is…

Q: 2. A. B. C. The DNA of each species has a different base composition. Find the base composition of…

A: Nucleotide subunits made up DNA's structure. Deoxyribose along with a phosphate group, and one of…

Q: 1. Written below is a DNA seqeunce: G G C A A C T A T C C C G A T T A G C G C Write down the…

A: Deoxyribonucleic acid (DNA) is a biomolecule found in nearly all living organisms. The structure of…

Q: 1. Which shows the correct complementary base pairing for DNA? a C-A, T-G b. C-G, U-A c. A-G, C-T d.…

A: The thread-like structure that consists of the genetic information of the organism, located within…

Q: Given the DNA sequence; 3’-GCTACGTCGC-5’ 5’-CGATGCAGCG-3’ What is the total number of hydrogen…

A: Hydrogen bonds: The electrostatic force of attraction which involves Hydrogen atom.

Q: Which of the following is true about the structure of DNA as proposed by Watson and Crick (B-form…

A: Introduction: Nucleic acids are large complex biomolecules that store hereditary information…

Q: One strand of a DNA molecule has the base sequence 5’-CACTTA-3’. The complementary base sequence on…

A: Deoxyribonucleic acid (DNA) is defined as an organic chemical molecule that will contain all the…

Q: a. Deoxyribonucleic acid (DNA) is a molecule composed of two polynucleotide chains that coil around…

A: DNA replication helps DNA to double itself.

Q: Below is a nucleotide base pair from B-DNA with three different regions indicated by A, B, and C. B…

A: B- DNA is the most common form of DNA. It is the right-handed helix and is present in humans which…

Q: he figure shows that the average distance between base pairs measured parallel to the axis of a DNA…

A: The nucleic acid polymer has nucleotide as its monomeric unit. synthesis of nucleotides is an…

Q: For entertainment on a Friday night, a genetics professor proposed that his children diagram a…

A: DNA Is a Polynucleotide. DNA is composed of nucleotides strung together to make a long chain called…

Q: Select the options that describe the correct pairings of the nitrogen bases in the DNA molecule.…

A: DNA is a nucleic acid that is a polymer of nucleotides that includes a nitrogenous base, a pentose…

Q: Which of the following pairs do not match? O DNA has an antiparallel : direction with 5'-phosphate…

A: DNA is composed of nucleotides which are composed of nitrogenous bases, a pentose sugar, and…

Q: The genetic distance between DNA sequences 1 and 2 is what value? 1 T G A A G G A T T 2 A T C А с C…

A: The genetic information of an organism lies in the DNA of that organism. DNA, a linear sequence of…

Q: Which of the following does NOT describe DNA as it occurs in Eukaryotic cells. CHOOSE ALL THAT…

A: Eukaryotic DNA DNA is the Deoxyribonucleic acid that constitutes genetic information and information…

Q: Chargaff's Rule implies the percentage of adenine-thymine pairs and the percentage of…

A: Base pairing rule : adenine(A) pairs with thymine (T) via two hydrogen bonds whereas guanine…

Q: Below is the 5’–3’ strand of a double-stranded DNA molecule with the following nucleotide sequences…

Q: Below are some nucleotide sequences located on a segment of one strand of DNA, from the 5'to the 3'…

A: Step 1 All nucleic acids are made up of nucleotides and in DNA (deoxyribonucleic acid), each…

Q: 1. Which of the following are generated due to the twisting of dsDNA? a. Hydrophobic bonds b. Van…

A: DNA acts as genetic material in most organisms. DNA is a double-helical structure in which two…

Q: Figure 3: BestrictriOR site map showing the following: A) linear DNA that is not cut as reference B)…

A: Restriction enzymes cut the DNA (deoxyribonucleic acid) at specific sites. These enzymes recognize…

Q: Below is a nucleotide base pair from B-DNA with three different regions indicated by A, B, and C. C…

A: If we represent the nitrogen base as a triangle, there are going to be three edges: Hoogstein Edge:…

Q: Given the banding pattern from the gel electrophoresis below, the nucleotide sequence of this…

A: Gel-electrophoresis:- it is used to separate the fragments of DNA, RNA, as well as proteins on the…

Q: Given the banding pattern from the gel electrophoresis below, the nucleotide sequence of this…

A: Electrophoresis separates the DNA strands based on their size. Thus, the smaller fragments sieve…

Q: Given the following eukaryotic DNA strand, transcribe and translate the DNA into a polypeptide using…

A: NOTE-"As per our honor code, we are authorized to answer only one question at a moment. As you have…

Concept explainers

Genome annotation

The technique of linking biological information to genome sequences is termed genome annotation. Gene annotation is the method of identifying gene locations and coding sections. It helps us understand what these genes are doing in the body through establishing structural characteristics and linking them to the actions of various proteins.

Question

Which two species in this DNA sequence alignment are the most closely related? Explain your answer referring to specific nucleotide positions to justify the choice you made.

Definition Definition A complex molecule that makes up a fundamental unit of a DNA or RNA molecule. Nucleotides are composed of a sugar, a nitrogenous base, and a phosphoric acid.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Introduction

VIEW

Explanation

VIEW

Conclusion

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Below is a sequence of DNA. 5'-ttaccgataattctctctcccctcttccatgattctgattaaagaaggcgagaacgaaactatttgttaatacc-3' Using the one letter code for Amino Acids, what is the predicted AA sequence of the shortest ORF (from N to C-terminal end)? Using the one letter code for Amino Acids, what is the predicted AA sequence of the longest ORF (from N to C-terminal end)?
If I tell you that a stretch of DNA in the 5' to 3' direction is AGGTACGACCGT Give me the complimentary strand without and spaces, commas, symbols or anything else besides the nucleotide sequence (e.g. only: AAGCATCCGCTTA). Give me the complimentary sequence in the 3' to 5' orientation.
In the following gel showing stained bands of the Alu insertion sequence, what is the genotype of individual 2? 941 bp 641 bp->>> 1 2 3 4 5 6 Homozygous for the 641 bp sequence that does not contain in the Alu insertion Heterozygous, containing one 941 bp sequence and one 641 bp sequence O Homozygous for the 941 bp sequence containing the Alu insertion
A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine Threonine
You are sequencing the following DNA molecule 3'- GACTACCGAAATTAT-5. Assume the annealing primer binds immediately prior to this sequence. What nucleotide will be found closest to the bottom of the sequencing gel? Multiple Choice G O A O C
6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…
Second Base Analyze the following DNA sequences: A UUU UCU UAU UGU Phe Tyr UUC UCC UAC UGC Original: AGAGAGAGAGAGAGAGAG Ser UUA UCA UAA Stop UGA Stop Leu UUG UCG UAG Stop UGG Trp CUU CCU CAU CGU His Mutated: AGAAGAGAGATCGAGAGA CUC CC CAC CGC Leu Pro Arg CỦA CCA CAA CGA Gin CUG CCG CAG CGG AUU ACU AAU AGU Ser Asn What amino acid sequence will be translated based on the AUC Ile ACC AAC AGC The mutated DNA? Hint* must transcribe and translate the AUA ACA AGA AAA arg Lys Met or Start AUG ACG AAG AGG mutated strand to find the answer. GUU GCU GAU GGU Asp GUC GCC GAC GGC Val Ala Gly G GUA GCA GAA GGA Glu GUG GCG GAG GG First Base Third Base
There are numerous methods for sequencing DNA, including classical Sanger sequencing, automated Sanger sequencing, and next-generation sequencing technologies, including Illumina technology. Match the modified cytidine nucleotide triphosphates (NTPs) with DNA sequencing methods that utilize them. Classical Sanger sequencing HO-P=O O HO-P=O O HO-P=O O Automated Sanger sequencing -NH₂ CH3 H₂CN ° ? ?N HOOOO OH OH OH NH CH₂ Next-generation DNA sequencing (Illumina) CH₂ NH₂ Answer Bank
If PBR322 is digested simultaneously with Pstl and BamHI, i. How many fragments are created? ii. Write down the base pairs that result at the 5' and 3' ends of the shortest fragment. HindIII ECORI | ECORV BamHI 4399 o 29 1es 4000 375 Sall Pstl 3607 tet amp 1000 PBR322 4361 bp 3000 ori 2295 2000 Ndel
me Insert Design at Painter 278 words Calibri Layout 11.5A A Aa BIU-abe X₂ X² A--A- ype here to search Font W Unique Unigriffin DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: References # M 3 How DNA Determines Traits- Transcription and Translation Fill in easier type.pptx part 2 - Word Tell me what you want to do... Mailings Review View A-6-5- LLI Paragraph | CAG TCG TTT | ATG GGG CTT CTT TIT | GAG AAT TCA CGC I S4 | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | wwwwww O 2 A W R =-- | TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | de in ACROBAT % 5 ¶ T 1 Normal AaBbCcDc AaBbCcl AaBbCcL AaBbCcDc AaBbCcDc AaBbCc[ AaBbCcD Aal 1 Body Text 1 List Para... 1 No Spac... 1 Table Par... Heading 1 1 Heading 2 Hea Styles Y 7 OM O 38°F JACQUI 10 L
A C Bo B D Out of the 4 base pairs that are shown, B and C are the ONLY Watson-Crick base pairs that are found in BOTH DNA and RNA The base pair seen in B is more stable than the Watson-Crick base pair shown in C partly because of a larger number of hydrogen bonds and partly because of more favourable pi-stacking interactions with adjacent base pairs. The base pair shown in D is almost never found in the DNA double helix. because the extra space occupied by the two purine bases would severely distort the helical structure normally generated by base pairs involving a pyrimidine base and a purine base. The base pair formed in A is less stable than the Watson-Crick base pair shown in B partly because of a smaller number of hydrogen bonds and partly because of less favourable pi-stacking interactions with adjacent base pairs.
wol for Frayon Elolog - Meet - cha-gX-m sc Jupiter Ed G Which orgerell= A sample of DNA is collected from an organism. It is analyzed and determined that 20% of the DNA is made up of the base adenine. Based on this information, which of the following correctly lists the amounts of the three. remaining bases for this sample? 10% cytosine, 30% thymine, 40% guanine O 20% cytosine, 20% thymine, 20% guanine 30% cytosine, 30% thymine, 20% guanine 30% cytosine, 20% thymine, 30% guanine p. 5 of 31