Q: If our DNA contains all the information about who we are, how can something that does not involve ch...
A: DNA is versatile and a very complex molecule , even more complex is the regulation of expression of ...
Q: Specificity in fusion between vesicles involves two discrete and sequential processes. Describe the ...
A: Enzymes are biocatalysts that aid in the acceleration of the reaction. They are proteins that serve ...
Q: Directions: Fill in the matching bases in each table from DNA to DNA, DNA to mRNA and mRNA to protei...
A: * The central dogma consists of Transcription Translation. * Transcription is the process of copy...
Q: rization, which ion moves and what direction (in or out) does it move? 2. What event causes the de...
A: Since you have asked multiple questions , we will solve the first question for you. If you want any ...
Q: DIRECTIONS: Using the Venn diagram as model of classification scheme, indicate the correct animal gr...
A: Introduction: Classification is the method in which anything is grouped into suitable classes based ...
Q: Why exosome complex destroys the mRNA ?
A: Exosomes are defined as vesicles which are nano metric-sized, being packed as biomolecules ranging f...
Q: In an experiment performed in C. elegans three forms of RNA (sense RNA, antisense RNA, and double-st...
A: The blocked gene expression would be observed more in doubled stranded RNA as compared to sense RNA ...
Q: Can you tell me the statistics for survival and prognosis for malaria?
A: INTRODUCTION Malaria is a disease that mainly caused bya Parasite. There are four types of ...
Q: Glucose-6-phosphate dehydrogenase (G6PD) deficiency is a disorder that affects the normal function o...
A: Introduction Glucose 6 phosphate is an enzyme that helps the RBCs operate normally in the body. G6PD...
Q: In Mendel early experiments with heredity in peas, he discovered that some have variable colors, som...
A: During the nineteenth century that headway was made in the understanding of inheritance. Mendel cond...
Q: The combined effects of exercise- released catacholamines on insulin and glucagon production are O d...
A: ANSWER) There are various effects of the exercise on the physiological functioning of the body, exer...
Q: What are the main respective components of cell walls in bacteria, protists, fungi and plants?
A: A cell wall is a structural layer found just outside the cell membrane that surrounds various types ...
Q: Antigens are proteins that illicit an immune response from the human body. Some vaccines contain the...
A: Any chemical that induces the body's immune system to react negatively to it. Pollutants, chemicals,...
Q: 1. How do the traditional and modern primate taxonomic systems differ? 2. Why would a scientist use ...
A: ANSWER;- 1. Traditional taxonomy is based on observations, morphological characters while modern is...
Q: How many times more greenhouse gas emissions does beef release, relative to chicken?
A: Greenhouse gas emission is the product of livestock rearing/production for multiple reasons (one of ...
Q: What is the correct order of permeability for the following four substances across a pure phosopholi...
A: The plasma membrane controls the passage of substances into and out of cells by being selectively pe...
Q: 10) Lacy is offered both water and a sports-electrolyte drink (which contains sodium and glucose) to...
A: Water is very much essential for us to stay hydrated as it plays a crucial role for proper function ...
Q: DNA from a strain of Bacillus subtilis with genotype a + b + c + d + e + is used to transform a stra...
A: Introduction :- The basic physical and functional unit of heredity is the gene. DNA is the material ...
Q: Type I fibers are only recruited in light repetitive movements like postural adjustment and slow wal...
A: The muscle fibres have a specialised structure that helps in contraction. Usually the actin and myos...
Q: Discuss the types of interferences in atomic absorption spectrophotometry.
A: Discuss the types of interferences in atomic absorption spectrophotometry. Introduction: Spectral i...
Q: What is the Pros and Cons of Cloning?
A: Answer Cloning is the brst way to increase the product in more number bearing the same generic mat...
Q: Explain the Pharmacodynamics and Pharmacokinetics of Inhaled corticosteroids. in detail Provide e...
A: Inhaled corticosteroids (ICS) are synthetic analogs made from the steroid parent molecule. ICS are h...
Q: The photomicrograph below shows mitotically dividing cells from whitefish (Coregonus lavaretus). a. ...
A: Mitosis is the process of cell division in which two identical daughter cells are formed Stages inc...
Q: Explain about Dicer enzyme ?
A: Metabolic pathways involve both synthetic and degradative processes. Many different chemical and ino...
Q: What are the different challenges and disadvantages that biodiversity suffers as we work our way to ...
A: According to the question, we have to discuss on the different challenges and disadvantages that bio...
Q: Distinguish between alternative complement pathway and Lectin pathway.
A: Introduction: Complement proteins: A system of plasma proteins that can be activated directly by pat...
Q: Is any new matter being made when a puppy grows or when corn grows
A: Introduction :- Growth in biological terms is defined as the increase in body weight with developmen...
Q: What are the adaptations of parasitic nematodes that make them successful as endoparasites?
A: Parasitic nematodes are round worms that depend on the host for their nutrition they belong to phylu...
Q: Polypeptides, DNA and RNA are important in the process of Prokaryote cells and in the evolution of l...
A: DNA, RNA, and proteins are all long polymeric biomolecules in which all the monomers are attached si...
Q: The 5'-Cap on viral MRNA plays a critical role in: Maturation and stability of the MRNA Translocatio...
A: In eukaryotes, the 5′ cap (cap-0), found on the 5′ end of an mRNA molecule, consists of a guanine nu...
Q: On average, in populations with genotype frequencies as they were in the original sample of 100 chil...
A: Introduction: Hardy – Weinberg Principle mathematically explains the occurrence and consistency of g...
Q: Write the causes for diabetes mellitus and diabetes insipidus.
A: Introduction In this question we have to write the causes for diabetes mellitus and diabetes insipid...
Q: If our DNA contains all the information about who we are, how can something that does not involve ch...
A: our DNA is what makes everything in our body works the way it does such as our hair colour , to our ...
Q: What is your stand on GMO especially in agricultural products? Do you agree that all food products s...
A: Any organism whose genetic material has been altered by genetic engineering procedures is referred t...
Q: 1. Why do we need to check the isolated DNA for its quantity and quality? 2. The purity of DNA samp...
A: Deoxyribonucleic acid DNA isolation is referred to the extraction process of DNA from different sou...
Q: Give 10 different cell parts. Explain their importance and normal activities/ function in the cell.
A: The smallest, most fundamental unit of life, the cell, is responsible for all of life's processes." ...
Q: What is the purpose of osmosis and diffusion lab ?
A: Osmosis and diffusion both are very important for living organisms. The transportation of different ...
Q: Describe the steps involved in vertebrate phototransduction by photoreceptors and further retinal pr...
A: The energy that allows us to see is known as light. A source of light, such as the Sun, emits light....
Q: 1. compare the dissected pig human models viewed in the lab book structure pig human number of l...
A: INTRODUCTION The comparision between different structures of pig and human is given below.
Q: Can you tell me about the survival and prognosis of malaria today, please?
A: Malaria is a vector borne disease caused by protozoan plasmodium species through female anopheles mo...
Q: A gene has two alleles, E and e. Another gene also has two alleles, T and t. Which of the following ...
A: Alleles are the alternative forms of a gene that are located on the same locus of a homologous chrom...
Q: Human ribonucleotide reductase has two allosteric sites, the S site and the A site. What is the func...
A: Human ribonucleotide reductase in a mammalian enzyme that is responsible for the conversion of RNA s...
Q: Q10
A: Ans- a) Maturation and stability of the mRNA The modification of mRNA 5′-ends by adding an RNA cap i...
Q: Blocking the ability of DNA methyltransferases to target the glucocorticoid receptor gene would like...
A: DNA methyltransferases These are a conserved family of cytosine methylases that are involved in epig...
Q: In squash soup, what are the enzymes and pigments present?
A: squash soup is Made with squash, ginger, rosemary & sage, it's super creamy . There can be some...
Q: Directions. Complete the table about the application of genetic engineering on the different fields....
A: Genetic engineering is the process of direct modification, manipulation and recombination of an orga...
Q: In a laboratory experiment, a researcher reports the use of an isotope 6C14 to trace the synthesis o...
A: C-12 and C-14 are two isotopes of carbon The difference among carbon-12 and carbon-14 is umber of ne...
Q: Explain the posttranscriptional roles of lncRNAs ?
A: Long non-coding RNAs (lncRNAs) play important roles in cancer. They are involved in remodeling of ch...
Q: What is nonsense-mediated decay (NMD) ?
A: Given: Non mediated decay is also called as non stop decay. This non stop decay pathway exists in al...
Mutation identity- GLY
Outline the effects the mutation will have on the 3D structure and function of the 3GRS glucathione reducatse protein.
Step by step
Solved in 2 steps
- Mutation identity- GLY Outline the effects the mutation of cysteine with GLY on the 3D structure and function of the 3GRS glucathione reducatse protein.Please select appropriate word in each bracket Many anti-cancer drugs affect nucleotide metabolism and inhibit DNA synthesis. For example, a widely used anti-cancer agent, 5-fluorouracil, is a pyrimidine analog that is incorporated into nucleotide form and affects DNA synthesis by inhibiting the activity of [ Select ] ["thymidine kinase", "ribunucleotide reductase"] , the enzyme required to synthesize [ Select ] ["dTMP", "dUMP"] . This inhibition of DNA replication affects both cancer and normal cells, and hence there are serious side effects of these agents including [ Select ] ["immune system suppression", "hyperallergenic reaction"] and damage to the [ Select ] ["lining of the GI tract", "connective tissue of cartilage"] . Methotrexate, was the first drug to actually cure a cancer, choriocarcinoma, in 1958, and serves to block the activity of [ Select ] ["dihydrofolate reductase", "serine hydroxymethyl-transferase"] , another enzyme required for the synthesis of dTMP.The full amino acid sequence of FABP6 is MAFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDF TWSQHYSGGHTMTNKFTVGKECNIQTMGGKTFKATVQMEGGKLVVN FPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA For the next step in your analysis, you ran a BLAST search of the PDB of this sequence and found a structure that is 59% identical to the sequence of your protein. The following is the alignment of two sequences (with your protein in blue (FABP6) and the homologous structure in red (3ELX)): Expect score = : 4 × 10−4² and Identities = 69/116(50%), Positives = 88/116(75%) 3ELX: 5 AFNGKWETECQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTWTQYYPNNHVMT 64 AF GK + E EC++ Y+ F KL GI DVI K R+FK+VTE+ Q+G DFTW+Q+Y FABP6: 2 AFTGKFEMECEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMT 61 3ELX: 65 NKF IVGKECDMETVGGKKFKG IVSMEGGKLT IS FPKYQQTTEISGGKLVETSTASG 120 NKF VGKEC+++T+GGK FK V MEGGKL ++FP Y QT+EI G KLVE ST G FABP6: 62 NKFTVGKECNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGG H MT 117 The identical amino acids are shown in black…
- Please help! Sketch a titration curve of the peptide Ala-Tyr-Gln-Met-Asp-His from pH=0 to 14 up to 5 equivalnets of KOH (Please type answer)Leu-Trp-Phe-Met-Ala-Ile-Val- Draw the structure of the peptide at pH7.4. and Indicate the hydrogen bonds formed in the alpha helix.NOTE: PLEASE SEND. CLEARER IMAGE PLEASE THANK YOU SOMUCH 2. Structural representation of tetrapeptide Phe-Met-Tyr-Asn
- Reposting - What would the tertiary structure of the dipeptide Asp-Ser be if it was made into a polypeptide chain? (Would it form a beta pleated sheet, an alpha helix, etc) Why would it do this? What properties of this polypeptide causes this? This sub part still needs to be solved - What would the tertiary structure of Pro-ala and Glycl-L-alanine be?CENTRAL DOGMA & STRUCTURE-FUNCTION RELATIONSHIPS IN PROTEINS You are a bacteriologist studying a pathogenic protein (the "BAD" protein) that contributes to diseases caused by Staphylococcus aureus. BAD functions as an aß heterodimer, and the a subunit (25kD) and ß subunit (75KD) are held together by an electrostatic interaction between K in the a subunit and D in the B subunit. You are trying to dissociate the BAD subunits to prevent pathogenesis in the bacteria. Which mutation would you make to prevent the BAD subunits from forming a dimer? Assume neutral pH. (A) introduce AAA → AGA point mutation in the a subunit gene (B) introduce GAC → GAG point mutation in the ß subunit gene (C) introduce GAT → CGT point mutation in the ß subunit gene (D) introduce two point mutations: AAG → GTG in the a subunit gene & GAC → CTC in the B subunit gene (E) introduce two point mutations: AAA → TGC in the a subunit gene & GAT → TGT in the B subunit gene second base in codon A TGT Cys TGC Cys TTT Phe…AAAGAGAAAAGAAUA to AAAGAGAAAUGAAUA. Suppose the codon sequence has a single base pair mutation If the old protein sequence was Lys-Glu-Lys-Arg-Ile, what will be the new sequence encoded by the mutant gene? (Use the 3-letter amino acid abbreviations with hyphens and no spaces in between, i.e. Ser-Asn-Tyr-Leu-Pro.) Submit Answer Retry Entire Group No more group attempts remain
- Determining the amino acid sequence in a protein usually in- volves treating the protein with various reagents that break up the protein into smaller fragments that can be individually sequenced. Treating a particular 11-amino acid polypeptide with one reagent produced the fragments: Ala-Leu-Phe-Gly-Asn-Lys Trp-Glu-Cys Gly-Arg Treating the same polypeptide with a different reagent pro- duced the fragments: Glu-Cys Gly-Asn-Lys-Trp Gly-Arg-Ala-Leu-Phe What is the amino acid sequence of the polypeptide?Peptide mass determination. You have isolated a proteinfrom the bacterium E. coli and seek to confirm its identityby trypsin digestion and mass spectrometry. Determinationof the masses of several peptide fragments has enabled youto deduce the identity of the protein. However, there is adiscrepancy with one of the peptide fragments, whichyou believe should have the sequence MLNSFK and an(M 1 H)1 value of 739.38. In your experiments, yourepeat edly obtain an (M 1 H)1 value of 767.38. What isthe cause of this discrepancy and what does it tell youabout the region of the protein from which this peptide isderived?Given: Cryo-EM structure of PCoV_GX spike glycoprotein 1. What can you tell me about the identity of the protein? 2. What is the importance of this protein?