How many exons does tra-RA contain? Q7. How many introns does tra-RA contain?
Q: What is an example of a biomolecule that interacts with Insulin? Please give a detailed explanation ...
A: Hormones are chemical messengers that transmit instructions from one cell to another. They are the p...
Q: write the orbital box diagram and dipole moment using the lewis strcuture for clo3^-: orbital name, ...
A: Lewis structure: Lewis figures show only an atom's valence electrons and the chemical symbol of a c...
Q: In a spectrophotometer, what should be the appearance on the graph if the sample is pure? presence o...
A: Spectrophometry is a widely used technique in identification and confirmation of chemical substances...
Q: With the aid of diagrams, explain the processes and principles of each of the following methods: ...
A: Enzymes have the ability to increase the rates of reactions in biological systems and this property ...
Q: You are working in a research lab that is surveying the CFTR gene sequence in humans to identify new...
A: A synonymous mutation is mutation in the DNA sequence that leads to change in the codon for amino ac...
Q: Ammonia, NH3, is toxic to a wide range of aquatic organisms including snails, insects, and fish. The...
A: The equation establishing the relationship between ammonia (NH3) and ammonium (NH4+) in water is as ...
Q: From the following protected amino acids, write the reaction equation to synthesize a tripeptide of ...
A: Merrifield solid technique describe the peptide synthesis using a solid support of hydrocarbon resin...
Q: Which functional site is found in the small subunit of the ribosome? peptidyl transferase centre O d...
A: Ribosomes, huge ribonucleoprotein particles with three RNA molecules and more than 50 proteins, are ...
Q: Starting from formaldehyde, ammonia, hydrogen cyanide, carbon dioxide, ethene and water as needed, s...
A: 4.5 billion years ago our planate originate from the solar system. at 1st billion years, there is...
Q: 1. You want to purify a protein using anion exchange column chromatography. In this technique, the ...
A: In anion exchange form of affinity column chromatography, since the solid state beads are positivel...
Q: Answer the following questions, showing work in the form of calculations. a) At what substrate conce...
A: Michaelis-Menten equation: Leonor Michaelis and Maude Mented created a simple model that accounts f...
Q: Given the findings of biochemist Erwin Chargaff about the composition of DNA. Answer the following q...
A: Answer : Chargaff's Rule : Another important piece of information about the structure of DNA comes f...
Q: What are the factors that affect carbohydrates?
A: Nutrients are those compounds that are present in the food that living beings intake for better and ...
Q: CH3CH2OH +HCOOH
A: Alcohol reacts with many kinds of acid to form esters. When alcohol and carboxylic acid reacts, the ...
Q: Create a Concept Map on the classification of lipids. There are two ways to classify lipid molecules...
A: Lipids: Lipids are a heterogeneous class of naturally occurring biomolecules that are soluble in o...
Q: Draw a schematic diagram of a double beam fluorescence spectrophotometer. Explain the desig...
A: Fluorescence spectrophotometer: It is a type of electromagnetic spectroscopy which analyzes fluores...
Q: Supercoiling of DNA requires GTP as source of energy is only observed in prokaryotes is no...
A: DNA is a genetic material present in most living organisms. In case of eukaryotic cells DNA is found...
Q: How to write a pre-lab preparation: lab notebook procedure(Density). And post-lab notebook (Density)
A: Before performing any chemical experiment in a lab, it is important to know how to write the Lab not...
Q: Question 10. What is the name of the procedure in which proteins separated on a polyacrylamide gel a...
A:
Q: How to use the sterile filter? Show the different sizes and specifications of sterile filters.
A: Sterilization is the method that is used to eliminate all forms of life and biological agents presen...
Q: Scientific evidence suggests that cells evolved as symbiotic relationships between bacteria (or prot...
A: Individuals of two (or more) distinct species have a close ecological interaction known as symbiosis...
Q: Why do we compute for TFM in soaps. How does one calculate for TFM? What is saponification? Show it...
A: 1. The TFM quantity interprets the quality of soap. It adds moisturizing properties to the product, ...
Q: Compound A below is a key intermediate in the synthesis of keto-myo-inositol B. Suggest a synthetic ...
A: Here compound C is D-Glucose D-Glucose is converted into Glucose-6-Phosphate in presence of Hexokina...
Q: Emtricitabine (2,3-dideoxy-5-fluoro-3'-thiacytidine, abbreviated as FTC) is a nucleoside analog that...
A: Given Values: [FTC] = 10 nM [HIV RT] = 37.5 nM [HIV RT-FTC] = 2.5 μM=2.5×103 nM
Q: Butanoic acid (C3H7COOH) is described as a weak acid. Define the term weak acid
A: Acids are chemical compounds that taste sour and turn the blue litmus red. They have a pH of less th...
Q: Complete the table below using the textbook or other information sources, if necessary. How will the...
A: A functional group is a group of atoms in a molecule that gives particular characteristics and chemi...
Q: Explain how the carbonate-bicarbonate buffer system works in balancing acid-base in the blood.
A: Buffers are solutions that have weak acid and its conjugate base. They nullify small changes in the...
Q: The industrial process for forming methanol involves a eatalyst Catalyst CO + 2H2 High p.T CH;OH Dra...
A: Methanol production on an industrial scale requires technologies that employ Cu-based catalysts. The...
Q: Draw and name the most prevalent anomeric form of glucose present in physiological systems?
A: Macromolecules are types of biomolecules that are needed in large amounts for the growth and develop...
Q: Please describe the hydrophobic effect and its contribution to membrane protein folding
A: The hydrophobic effect being the major driving force for the membrane protein folding
Q: но -H- HO -H- HO H- -HO- 3.) HO. + Orcinol/HCI
A: The term "biomolecule" refers to a molecule created by living organisms or cells. The most common bi...
Q: Describe the characteristics of the extracted DNA, such as colour, shape, size, and consistency.
A: Deoxyribonucleic acid (DNA) is a genetic information-encoded molecule. This information is used to p...
Q: Describe the role of glutamine and glutamate in amino acid metabolism.
A: Glutamine: It is a non-essential amino acid as it is produced by our body. It is the primary amino ...
Q: The following were obtained in a study of an enzyme known to follow Michaelis-Menten kinetics: R...
A: Enzymes are proteins which accelerate the rate of biochemical reactions. The Michaelis-Menten plot r...
Q: COO COO C -NH2 CH2 CH2 1 3 CH2 CH2 CH2 4 CH2 H- -NH3 -NH3 H- C COO CO- А C a. Aminotransferase is th...
A: Ans). A) Glutamine B) Glutamate C) α-Ketoglutarate
Q: What is the Rf value of each amino acid observed?
A: Rf ( retardation factor):- It is defined as the ratio of distance traveled by the centre of a spot (...
Q: To which class of enzymes does each of the following belong?
A: Enzyme classification in needed to name the enzymes. According to the Enzyme Commission there are si...
Q: In elongation, the creation of peptide bonds between amino acids is catalyzed by a. rRNA. b. a prote...
A: The letters of the nucleic acids are translated into amino acids, i.e., from nucleotide language to ...
Q: Topoisomerases can cut phosphodiester bonds and the DNA ligases will have to seal the nicks whenever...
A: DNA ligases are enzymes that catalyze formation of a phosphodiester bond at a single-strand break in...
Q: What are the different physical and chemical properties of lipids?
A: According to the chemical structure lipids can be classified into three main types of lipids. They a...
Q: 2. Consider the following pigments. OH HO NO G O,N NO (a) Provide the mechanism for the chemical rea...
A: The pigment in the question are Azo pigmnet/dye and is organic compound contains Azo group (-N=N-). ...
Q: The proteins and other substances that bind to the DNA rely mostly on non-covalent interaction to de...
A: Proteins are an important class of biomolecules that are found in all living organisms and are compo...
Q: Describe how the following properties affect the function of a protien: A.) R group orientation B.) ...
A: Amino acids are biomolecules that are comprised of two functional groups, these are an amino group (...
Q: Do glycolic acid and lactic acid belong to the same homologous series? Give a reason for your answer...
A: Homologous series is a series of chemical compounds having similar chemical properties and some of t...
Q: classify the ff lipids whether it is simple,complex or derived: 1) lecithin 2) tallow 3) retinol 4...
A: Lipids: Lipids are a heterogeneous group of chemical compounds that includes fats, oils, waxes, ste...
Q: Wavelength vs. Absorbance UV - VIS Residual Graph 0.05 -0.05 -0.1 -0.15 -0.2 -0.25 220 240 260 280 3...
A: The residual plot shown here is Wavelength Vs Absorbance plot has unique pattern. Here, plot is show...
Q: You are about to isolate a 3000 bp large plasmid from an E.coli culture. You know that the plasmid i...
A: 1 DNA bp weight = 650 g Given : 100 plasmid copies per cell Plasmid concentration= 100 ng/microL
Q: Draw the C-2 epimer of Ribose
A: Epimers are a pair of diastereomers, at one stereogenic carbon center of two epimers have at least...
Q: One of the main sources of sphingosine in the body is in the cell membrane. What complication could ...
A: Ceramide: These are the type of lipid molecules composed of sphingosine and fatty acids and are foun...
Q: A solution of calcium phosphate in water contain 235 gms of CP per L at 30 deg c. The density of the...
A: Percentage composition is calculated as the percentage by mass of individual elements contributed to...
Q6. How many exons does tra-RA contain?
Q7. How many introns does tra-RA contain?
Gene is a portion of the genome that can be transcribed or a functional unit of the genome that can be transcribed. The genome size of a human is 3200MB categorized into 2 parts repetitive sequences and genes or gene-related sequences. Genes are made up of exons (coding sequences) that code for a particular protein or enzyme while introns are non-coding sequences. In eukaryotes, introns and exons are present on hnRNA. During RNA processing, splicing of introns occur. It required 2 esterification reactions that will remove introns from mRNA. mRNA contains only coding sequences (exon) which further do the translation to form the particular protein.
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- 11.5 A A Aa-AE-E-¹5- U - abe X₂ X² A-ay-A- Font Ulla Unigriffin DNA: mRNA: amino acids: traits: DNA: traits: mRNA: amino acids: · DNA: mRNA: to search #N O E Et CE- Paragraph $ 15 Ser 1. CAT AGG GAG | CAA GGG TGA CTT TTT | AAT AAT GAC GGG | A E ALT | CAA TTG TTA CGG | AAA AGA CCC | GCC ATA ACA TTT | % STP | CAC CGT CGA | GTA GTA | AGA GGG CAT | TTG TAA GGA GGG GGG TGT | 16 AaBbCcDc AaBbCcl AaBbCcL Aa BbCcDc 1 Normal 1 Body Text 1 List Para... 1 No Spac... W] Tyr 17 Val & 7 Gly E CO OM no num lk T Aa Bb Cc 1 Table Pa (p)) Styles 12 PBM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation LeadpleAn adult with a history of tanning has his genome sequenced. The beginning of a protein-coding region of his DNA reads ATGGGGATATGGCAT. If the protein-coding region of a healthy adult reads ATGGGGATATGAGCAT, identify the site and type of mutation.
- Cynt Classifying mutations A certain section of the coding (sense) strand of some DNA looks like this: $-ATGTATATCTCCAGTTAG-3" It's known that a very small gene is contained in this section. Classify each of the possible mutations of this DNA shown in the table below. mutant DNA 5- ATGTATCATCTCCAGTTAG-3' S-ATGTATATCTCCAGTTAG-3 5- ATGTATATATCCAGTTAG-3' type of mutation (check all that apply) insertion deletion point silent noisy insertion O deletion point silent noisy insertion O deletion point silent Onoisy X G#4 BamI --- 5’ CCTAG ↓G 3’ 5’ ACGCCTAGGACGTATTATCCTAGGTAT CCGCCGCCGT CATCA 3’ 3’ TGCGGATCCTGCATAATAGGATCCATAGGCGGCGGCAGTAGT 5’ Restriction enzyme: Recognition sequence: Number of pieces of DNA: Type of cut:48 Second letter If any single nucleotide is deleted from the DNA sequence shown below, what type of mutation is this? UUU U UUC UUA UCU Phe UCC UAU UGU Cys ANTISENSE 5' GGACCCTAT3' UAC Tyr UGC UAA Stop UGA Stop UAG Stop UGG Trp Ser UCA Leu UUGL" UCG CUU CU CAU) His CAC) CGU CGC CGA Arg CUC C Leu Pro CAA1 Gin CAG) CUA CCA CUG CG CGG AAU AAC Asn AGC AAA AAG Lys AGG Arg AUU ACU AGU Ser AUC lle ACC Thr AUA ACA AGA AUG Met ACG GCU GCC GUU GAU] GGU GUC Val GAC Asp GGC Ala Gly GUA GCA GAA GGA Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a FRAMESHIFT SILENT NONSENSE MISSENSE Third letter First letter
- pcc300ATAAADATATAOOTTAA 1. Use the genetic code table and the information in the diagram below to determine the amino acids that would make up the portion of the polypeptide shown. Include information for a key as well. DNA template 3' G CATA ACAGAGGATT-5' al bnsua AMAm pniwollot erfT E transcription s yd bnsita ebitgeqylog s sidmeaze of beae RNA strandUU UAOUOUU A-emoaodin 5'-CGUA AUUGUC UCCUUA- 3' J J JL erit o elinW (s) translation bluow terdt aspnso sigootiwsone polypeptide viemetis ns ebivo19 (d) ent ot etslanT Key:Design 6 bp primers to amplify the region of this sequence that is highlighted in yellow. attatatttt atattatata ctctgggctc agagcagccc 40 41 atattatata tatatatttt aaaatattat aaatttattt 80 81 cagtcacgcg tcctgatgac attatatttt ataatttttt 120 121 ttttattttt attatatttt aaaatattat aaatttattt 160 161 aaaatattat tatatattta aaatttattt attataaaat 200 201 aaaatattat ttttattttt gagatcagga cggctgcatg 240 Forward primer Reverse primerEukaryotic Genetic Sequence: 5'-TAC CAT GAT CCC TAT - 3' 1. What would be the newly synthesized DNA strand and explain how the strand will be replicated. Where in the cell would this occur? 2. What would be the synthesized mRNA strand, and how is it transcribed from the original DNA strand, and then converted from a pre-mRNA strand to a mature mRNA? Where in the cell does this occur? 3. What would be the anti-codons for the tRNA. What are the amino acids generated based on the RNA. How are these amino acids translated into protein and where in the cell does this happen?
- 5' UGG CAA UCC UAC GAU 3' - 1. Here is the MRNA sequence from a section of a gene (it is the middle of the sequence, so it has no AUG). What is the template sequence of this gene? - 2. Are any of these codons in the MRNA non-degenerate? If so, indicate which one. e 3. 4 a) Translate this mRNA section. Give the 3 letter codes for the amino acids. b) Indicate on the peptide which is the C terminus and which is the N terminus. e 4. Is it possible for a single base pair substitution to cause a truncation in this peptide? If so, e explain how. e 5. Write out the sequence of the anticodon in the tRNA that would bind to the fourth codon in the e MRNA. e 6. Write out a possible miRNA that could regulate the expression of this geneIII. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…Biol 1406-Lec 17 - Gene Exp X acconline.austincc.edu/ultra/courses/_891351_1/cl/outline Question completion Status. Blackboard Learn Which of the following stater X 9. Which of the following statements about transcription is not true? In both prokaryotes and eukaryotes, pre-mRNA is modified after transcription by adding a 5' cap and a 3' poly-A tail and splicing out introns leaving coding exons. Paraphrasing Tool - QuillBot Your disk is almos Save space by optir O During transcription only one DNA strand called the template strand is read and rewritten by RNA polymerase with the template strand read in the 3' to 5' direction and the mRNA transcript synthesized in the 5' to 3' direction. O During initiation of transcription, RNA polymerase binds to the promoter region in the DNA, unwinds the DNA and binds together RNA nucleotides complementary to the template DNA strand. O During initiation of eukaryotic transcription, the promoter region contains a TATA box in which transcription…