give the structure of PNA Sequence and give the 5'-AGCTA-3 Complete Seturaute Structure of Complementry and and Rhes Squence of the DWA sequence abure.
Q: Which of the following are the likely explanations for the failure of a postsynaptic neuron to…
A: The postsynaptic element is often the soma or dendrite of a postsynaptic neuron. The other side of…
Q: 1. Of the three processes - filtration, reabsorption, secretion - which is (are) accomplished by a…
A: Kidney dialysis accomplished all three processes filtration, reabsorption and secretion. The…
Q: Which of the following is true about the pituitary gland The pituitary gland is located beneath the…
A: A) Yes, the pituitary gland is found attached to the hypothalamus, hanging with the help of a stalk…
Q: 50 um Figure 3. Grasshopper testis with differential staining and viewed under a microscope.…
A: Meiosis is a type of reductional cell division consisting of two consecutive stages- Meiosis-I and…
Q: Describe the transcription.
A: DNA is a genetic substance found in all living organisms, from single-celled microbes to…
Q: Define peripheral resistance
A: Introduction The cardiovascular system is also called the circulatory system. It consists of the…
Q: 14C methyl pyruvate is added isolated liver tissue and malonate is used to break succinate…
A: Introduction :- Succinate dehydrogenase (SDH) is a metabolic enzyme complex found in mitochondria…
Q: Answer questions 12-16 , I need the letter of your answer
A: Environment refers to the area where organisms live. Ecosystem is the organised community of living…
Q: Discuss the regulation of the tryptophan operon. How does this story change under the two…
A: Introduction: The trp operon is a collection of genes found in E. coli bacteria that code for…
Q: Describe how the skin and mucous membranes play an integral role in helping the body protect itself…
A: The immune system fights microorganisms and foreign objects on the epidermis, in human tissues, and…
Q: For each level of your species taxonomy explain why it is a part of that section of the hierarchy…
A: The Giant Panda is a bear species found in central and western China's highlands. The Giant Panda is…
Q: A synapse with all of these; a postsynaptic dendrite, an astrocyte end foot, and the presynaptic…
A: Introduction :- Synapses are part of the circuit that connects sensory organs in the peripheral…
Q: - In a paragraph explain a) What is resident flora? b)How might resident flora prevent infection…
A: Healthy people live in harmony with most of the microorganisms that establish themselves on or in…
Q: Discuss the antigen and antibodies relative to 8 blood groups
A: The ABO blood group is represented by substances on the surface of red blood cells. The substances…
Q: How many human proteins are in the range of 250,000 to 900,000 Daltons?
A: The human body is thought to have over a million different types of protein, and even a single-cell…
Q: Assigned Multiple Choice Question Please post the question that you were assigned below During DNA…
A: DNA polymerase III only synthesises DNA in the 5'-3' direction. Ans ) True DNA chain elongation is…
Q: The general requirements for protein transport are signal peptide, receptor, translocase complex and…
A: The Central Dogma theory explains that DNA makes DNA through the process of Replication. DNA makes…
Q: Yoghurt starter culture is a mixed population of S. thermophilus and L. bulgaricus, both competing…
A: The living beings on this planet have been broadly divided into two categories - Plants and Animals.…
Q: When selection favors homozygotes over heterozygotes it is likely that... Incorrect answer - both…
A: Natural selection is a theory that states that organisms evolved by changing their heritable traits…
Q: Define the meaning of nosocomial infection and explain three potential exogenous sources
A: Nosocomial infections are also termed as hostipal-acquired infections. These are those infections…
Q: Which female reproductive structure is equivalent in development to the penis in males
A:
Q: Please explain why Cucumis bloomingtonii is sterile.
A: Sterile The plant or animal which can't produce viable gametes.
Q: A device called a hemocytometer is used to measure the amount of hemoglobin present. Red blood cells…
A: Cancer is a fatal disease that has both physical and mental consequences for a person. Cancer can…
Q: • Name the function of each hormone listed and the structure that produces each of those hormones: o…
A: Hormones are the chemicals that are responsible for controlling and regulating the activities of…
Q: 1. Explain the divisions of the nervous system. 2. Summarize the events involved in the synaptic…
A: Note :- Since you have asked multiple questions im only answering the ist 3 as per bartleby…
Q: What is the antagonist
A: Muscles Muscles are the soft tissue of the body and they help in movement and joining of bones.
Q: Plants
A: Plants are very useful in our daily life. Plants are used to yield fuel, medicines, tools, alcohol,…
Q: What is the specific base sequence found in human telomeres, and how does the base sequence…
A: The physical end of the chromosomal is known as Telomere. It protects the chromosome's ends from DNA…
Q: Histones are proteins that are found to be challenging to investigate and part of an enormous family…
A: Histones/ Histone protein : Histones are a family of basic proteins that associate with DNA in the…
Q: Q 1 Indications of operative dentistry can be seen in all of these except: A-Carious tooth B-…
A: Introduction Operative Dentistry:- It deals with treatment, diagnosis & prognosis of defects of…
Q: In what ways would you expect forced migration to have an impact on the phenotypes of animal…
A: Introduction Migration is that the movement of individuals across entirely different states and…
Q: You made four mutants for a promoter sequence in DNA and studied them for transcription. The results…
A: Promoter are the sequence present in the DNA. These allow the binding of transcription factor and…
Q: why do mangroves prefer to thrive in upper intertidal or optimal level tidal zones than lower…
A: Introduction Mangrove forest- Mangrove trees and shrubs grew in coastal intertidal zones. Mangrove…
Q: Describe the difference between population density and dispersion Why do you think the population…
A: Population density Population dispersion It is a measure of number of individuals of a population…
Q: -Discuss how the presence of glucose impacts the expression of the ara operon.
A: Introduction: The L-arabinose operon, which is called the ara or araBAD operon, for the breakdown of…
Q: Transcription
A: RNA polymerase synthesizes an RNA transcript complementary to the DNA template strand in the 5' to…
Q: 1. What is the active substance and activity/indications (e.g. antibacterial, anti-inflammatory) of…
A: Plants are vital living forms that belong to the Plantae taxonomic kingdom and are further classed…
Q: Do you think it's possible to capture energy from photosynthesis for human use? Use the information…
A: Introduction: Photosynthesis is the process by which plants convert sunlight, moisture, and carbon…
Q: Identify the fixation and embedding protocols of seed tissues for microtome sectioning? How thin…
A: Microtome A microtome is a mechanical instrument which is used to make thin slices of tissues. Thes…
Q: Why is the regulation of body fluids important in living organisms?
A: Introduction Homeostasis is the ability to maintain a relatively stable internal state that persists…
Q: capZ encourages the elongation of actin filaments (true or false) 2)microtubules are tissue…
A: capZ or capping protein involved in assembly and disassembly of actin filaments. capZ cap the…
Q: SBI3C: Case Study-Smoking and Lung Cancer /16 Cancer usually begins in the bronchi or bronchioles.…
A: Answer d Cilia, which are hair-like projections that transport microorganisms and detritus up and…
Q: During meiosis both recombinant and parental type chromatids are created. Which of the outcomes…
A: The meiotic division is characterized by the formation of recombinants. This phenomenon is achieved…
Q: Use Punnett squares in solving the following problems. 1. In garden peas, a plant that is homozygous…
A: A genotype is a group of genes in DNA that are accountable for a specific trait or feature, whereas…
Q: What is the actual meaning of Biocompatible and biodegrable for the scaffolds for biomedical…
A: Introduction A polymer is a natural or manmade substance made up of large molecules termed…
Q: Think about the important functions of telomeres. Now, imagine a scenario in which a mutant…
A: Introduction Telomeres are repeating sequences that protect the natural ends of linear eukaryotic…
Q: 2. Complete the table below for the hormones involved in blood glucose control. Insulin Glucagon…
A: Diabetes is a disease of blood sugar and it is caused by a low level of insulin or nonfunctional…
Q: Draw a diagram that illustrates how these chromosomes pair up during Metaphase I of Meiosis. Be sure…
A: Metaphase I Meiosis is also called reductional division as it results in the production of 4 haploid…
Q: A man has six digits on each hand and foot (an autosomal dominant trait). His wife and first…
A: A condition in which an individual has more than 5 digits is known as polydactyly. Polydactyly is an…
Q: Compare the process of cell division between eukaryotic and prokaryotic cells and list four aspects…
A: Introduction: The distinction between prokaryotes and eukaryotes is widely regarded as the most…
Give a clear handwritten answer with explanation
Step by step
Solved in 2 steps with 1 images
- Nucleic Acids Convey polypeptide c' minal directi This ques similar to t' carboxy-ter- hesis ing synth to direct sis, the Secon yase aft e genetic groups of 44. Why is ATP important to protein function, and how is it used to accomplish this? which st is. The m fatthaei, synthetic able of r ataining r thus mus ucleotid h of mor Cwas the chemis re critir a 1966 ponded han our PROT mine the s tetail sizerHN, NH. NH H2N° А. В. Consider the 3 structures shown. Which of these is (normally) NOT present in either DNA or RNA? (select all that apply) А В none of the above ZI C.G-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart ac
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…0ミレーNレ NH geometry on both cand N. Torigonal plannes CH - C-N o=), HN CH2 CH-C-OH (a- carbon) CH2 HooC Aspaxagine - Toline - Valine - Arginine - phenylalcmine - Glutamic ocid. 1.Give the name and three letter code for each amino acid in the peptide. e 2. At pH 7, approximately what charge would be on your peptide? Explain your answer. 3. Can your peptide form intra/interchain disulfide bonds? Explain why/why not. e 4. Will your peptide absorb UV and is it fluorescent? Explain why/why not. e 5. What is the probability that your peptide contains a cis peptide bond? Explain your answer.5'-TAGCTGATCGAATATGCGGTCTCTATCTTCGTAGACGA-3' 3'-ATCGACTAGCTTATACGCCAGAGATAGAAGCATCTGCT -5' Determine the amino acids that will be encoded by this sequence Second letter First letter U C A G U UUU Phe UUC UUA UUG Leu CUU CUC CUA CUG Leu GUU GUC GUA GUG Val UCU UCC UCA UCGJ AUU AUC lle AUA ACA AUG Met ACG CCU CCC C CCA CCG ACU ACC GCU GCC GCA GCG Ser - Pro Thr Ala A UGU UACTyr Cys UGC. UAA Stop UGA Stop A UAG Stop UGG Trp G CAC His CAA Gin CAG GAUT GAC Asp GAA AAU Asn ACC Ser AGU AAG LYS AA Glu GAGJ Oa. N-Met-Arg - Ser-Leu-Ser - Ser-C Ob. N-Met-Pro-Arg - Asn-Asp - Ser-C d. N-Met-Lys - Val-Glu-Ala-C Oc. N-Asp-Pro-Lys - Ser - Val-Ile-C Oe. N- Met-Ala-Asp-Pro-Lys - Ser-C G CGU CGC CGA CGG AGA AGG. GGU GGC GGA GGG Arg SCAO Gly U UCAG UUA DUAG Arg G Third letter 13
- Oh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…Draw the peptide at a pH @1 of Cys-His-Glu-Met-Ile-Ser-Thr-Arg-Tyr - do it on this formatSecond letter A UUU UCU) UC UCA UCG UAU UUC Phe UUA Tyr UGU UGCJ Ser UAA Stop UGA Stop A UAG Stop UGG Trp UUG Leu CAUHIS CUU CUC CUA CUG CCU* C ССА CCG CGU His САС Leu CGC Arg CGA Pro CAA Gin CGGJ Gln Which amino acid is carried by the TRNA with the anticodon 5'-UCA-3? ACU ACC ACA AAU AAC. AGU AGC AGA AUU Ser Asn AUC Ile A AUA Thr AAA Lys AAG Lys AGG Arg AUG Met ACG GAU GGU] GUU GUC GUA GUGJ GCU GCC GCA GCG GAC Asp Ala GAA GGC Gly GGA Val GAG Glu GGGJ Isoleucine. None-this is a stop codon. Aspartic acid. Histidine. IV. Leucine O V. Third letter UCAG UCAG UCAG First letter
- I. A protein, X, was Isolated from a pathogenlc mlcroorganism. The proteln Is a vlrulence factor whose path0genlclty lies In a heptapeptide of unknown sequence. After trypsin cleavage of the heptapeptide from protein X, the peptlde's compOsition and sequence was determined. The fOllowing were the results of the sequenclng process: 1. When the peptide was treated with dinitrofluorobenzene (DNFB), DNP-asp and a mixture of amino acids were produced. 2. When the same Intact peptide was treated with streptococcal protease, a pentapeptide of composition asp, asN, cys, gly and ser and 2 amlno acids were released. 3. When the heptapeptlde was also treated with hydrOxylamine HCI, a tripeptide and a tetrapeptide were obtained. The C-terminal amino acid of the tripeptide was asN. 1) What is the sequence of the heptapeptide if it is composed of cys, asp, lys, asN, gly and ser only? 2) What is the pl of the heptapeptide?5' UGG CAA UCC UAC GAU 3' - 1. Here is the MRNA sequence from a section of a gene (it is the middle of the sequence, so it has no AUG). What is the template sequence of this gene? - 2. Are any of these codons in the MRNA non-degenerate? If so, indicate which one. e 3. 4 a) Translate this mRNA section. Give the 3 letter codes for the amino acids. b) Indicate on the peptide which is the C terminus and which is the N terminus. e 4. Is it possible for a single base pair substitution to cause a truncation in this peptide? If so, e explain how. e 5. Write out the sequence of the anticodon in the tRNA that would bind to the fourth codon in the e MRNA. e 6. Write out a possible miRNA that could regulate the expression of this geneSuggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA