Q: What is the function of antidiuretic hormone? Group of answer choices 1. It increases the…
A: ADH, also referred to as vasopressin, is a hormone that the hypothalamus produces and the posterior…
Q: Does modern medicine affect natural selection in the human species today? Explain
A: A species is a fundamental unit in biological classification and represents a group of living…
Q: can you elaborate on why the plus one is to the 26 and the 24?
A: When calculating the distance between two genes on a chromosome, we use the genetic concept of…
Q: Why aren't wind turbine blades with tubercles inspired from the humpback whale flippers more used…
A: An increasingly common renewable energy source is wind energy. Turbine blade layout is essential to…
Q: Briefly compare in vivo enzyme systems to in vitro enzyme systems for the testing of ecotoxicology.…
A: Specialized proteins called enzymes catalyse or speed up chemical processes in living things. They…
Q: encapsulated? aq suaбoyied jе Јолеј иопnjолә ,иром Áym uu uoid ulias joj aбeque^pe uevlodur ue s…
A: A significant public health problem continues to be the emergence and re-emergence of infections. As…
Q: Below is shown a recombination intermediate between two non-sister chromatids (both strands of the…
A: Two homologous non-sister chromatids pair up with each other and exchange different segments of DNA…
Q: Imagine that you have done a cross between two strains of yeast, one of which has the genotype A B C…
A: The scoring patterns in both tetrads indicate that recombination has occurred between genes A and C,…
Q: A) B) C) D) E) 8) List 5 ways that the current novel coronavirus and the disease it causes differs…
A: The coronavirus, also known as COVID-19, is a respiratory illness caused by the SARS-CoV-2 virus. It…
Q: RNA differs from DNA in that: a) The ribose in RNA nucleotides contains fewer oxygen atoms than does…
A: DNA = Deoxyribonucleic acid is a polymer. Which is composed of two polynucleotide chain. That chain…
Q: You have recently cloned multiple cDNAs for a gene you are studying. After sequencing ten of the…
A: The process of cloning cDNA involves creating duplicates of a gene's coding sequence by converting…
Q: Which of the following statement is correct regrading recombination frequency map units? Two genes…
A: Recombination frequency is the probability that two genes located on the same chromosome will be…
Q: 3. In 2015, the WHO surveyed 10,000 people on the subject of drug resistance. Seventy-five percent…
A: Treatment for infections brought on by bacteria resistant to antibiotics might be challenging or…
Q: The following phenotypic change of a bacterium is possible by transfer of DNA by "'conjugation". A)…
A: Toxins are substances produced by microorganisms including bacteria that can cause harm or disease…
Q: For the cricket, the intrinsic growth rate is 100 and the carrying capacity of the environment is…
A: Population dynamics in ecology relates to the shifts in population size and composition throughout…
Q: Explain how polyploidy in plants can generate new plant species. Be sure to provide molecular…
A: Polyploidy refers to organisms that have more than two sets of chromosomes in their cells. While…
Q: Explain why do cells require RNAi
A: The phenomenon of regulating gene expression is known as gene silence. At the level of transcription…
Q: Image source: https://anatomy adphysiology.com/homeostasis- positiveneqative-feedback-mechanisms/…
A: The ability to maintain a stable internal environment in the face of changing external conditions by…
Q: The fundamental mechanism of the complement system?
A: The complement system is a complex system of proteins and enzymes that work together to help the…
Q: g the USA population are also provided and will be used to determine the "Expected" frequency nts.…
A: In chi square test expected frequencies are calculated by first determining the expected ratios and…
Q: Question 1 In the mid-1890s, the discovery of which of the following aroused great public excitement…
A: X-rays are a type of electromagnetic radiation with a wavelength shorter than that of ultraviolet…
Q: 2. Describe or draw the most suitable immunological assays or experiments for the following…
A: Designing suitable immunological assays for different scenarios can be critical for the timely and…
Q: regarding the USA population are also provided and will be used to determine the "Expected"…
A: According to Hardy Weinberg equilibrium, both allelic and genotypic frequency will remain the same…
Q: Although numerous treatments are available for advanced hormone receptor- positive (HR+) and human…
A: Cancer is a group of diseases characterized by uncontrolled growth and spread of abnormal cells.…
Q: After performing analysis of whole genome sequencing from a candidate that grew on SC-H in the…
A: In genetic screening, a candidate that grows under specific conditions is analyzed to identify the…
Q: 6) The host (human) protein that serves as the virus receptor is: The normal function of this human…
A: Coronavirus: The coronavirus, also called the SARS CoV -2 virus, is responsible for causing the…
Q: Why do insertion mutations have a bigger effect on the protein than substitution mutations? Please…
A: Mutations: Mutations are the change in the sequence of the DNA( Deoxy ribonucleic acid ). Types of…
Q: The most commonly found phenotype in the natural population of a species is called the?
A: Phenotype refers to the physical and observable characteristics of an organism that are determined…
Q: Briefly describe the regulation of leptin and some of the sites of leptin action.
A: Leptin hormone The purpose of leptin hormone is to regulate energy balance by controlling food…
Q: **Monoclonal antibodies and Polyclonal antibodies What are the differences? How to make them?…
A: Antibodies, also known as immunoglobulins are proteins produced by the immune system in response to…
Q: What is the optimal growth conditions of FECAL coliforms in freshwater. Discuss it in detail (such…
A: Freshwater resources are critical to human survival, but they are also susceptible to contamination…
Q: Select the alternatives that indicate an advantage of GMOs. A. GMOs can have improved nutritional…
A: Plants or animals that have had specific genes modified in their genetic makeup are known as…
Q: Solution is wrong, it is not option D. Could you please give correct answer?
A:
Q: Which of the following is true under the following conditions: The enzyme concentration is 8 nM, the…
A: The KM (Michaelis-Menten constant) is a measure of the affinity of the enzyme for its substrate. It…
Q: what is the optimal growth conditions of E.coli in freshwater. discuss it in detail.
A: Escherichia coli (E. coli) is a Gram negative, rod-shaped bacterium that is commonly found in the…
Q: the name of the intramolecular structures that RNA can form is called a. hairpin b. supercoil c.…
A: Ribonucleic Acid, also known as RNA, is a class of biological molecule that is crucial for both…
Q: A 35 year old woman of Chinese ethnic background (Guangdong province) presented with a near normal…
A: Summary of results for each family member:
Q: Which of the following create unique fingerprints for every individual? (Select all that apply)…
A: Fingerprints are distinct ridged and valley patterns on the fingertips, palms, and soles of the…
Q: What is the distance in cM between genes A and C if the data obtained following crossing parental…
A: GENETIC MAPPING : A genetic map is based on the concept of genetic linkage: the closer two markers…
Q: What is Janka rating and semi-consistent density?
A: The Janka rating is a measure of the hardness of wood, which is determined by measuring the force…
Q: in humans brown eyes (B) are dominant over blue (b).A brown eye man marries a blue-eyed woman and…
A: From the question, we get Brown eyes (B) are dominant over blue (b). A brown eye man marries a…
Q: About 70% of American perceive a bitter taste from the chemical phenylthiocarbamide ( PTC ). The…
A: The genotype refers to the genetic makeup of an individual, which consists of the combination of two…
Q: why does fresh milk curdle when vinegar or lemon juice is added ?
A: The building blocks of all living things are proteins. Every cell in the human body contains…
Q: Which species causes the waterborne disease giardiasis? euglenoids trypanosomes diplomonads…
A: A waterborne disease is an illness caused by microorganisms that are transmitted through…
Q: Distinguish between gross primary productivity (GPP) and net primary productivity (NPP)
A: Energy flows through natural pathways and biogeochemical cycles. This includes the flow of amounts…
Q: A combinatorial library was screened using microtiter plates for bactericidal antibiotics, compounds…
A: Antibiotics are chemical substances. These are used to retard the growth of microbes. These…
Q: QUESTION 19 You are interested in observing Archaea motility under a microscope. What do you see? •…
A: Archaea, also referred to as archaebacteria, are a class of prokaryotic single-celled microorganisms…
Q: Move Substance Oxygen How does it cross the membrane? (through the membrane/through a protein/…
A: The cell is the basic, functional, and fundamental structure of all biological entities. It is…
Q: 8. Select the statement that is FALSE: * O Some cells, like stem cells or skin cells, are constantly…
A: Mitosis is a type of cell division that occurs in somatic (non-sex) cells and results in two…
Q: a) Gill lice infections result in lowered surface area to volume ratios in fish gill structure.…
A: Gill structure in fish is composed of thin, flat filaments that are highly vascularized. The…
Step by step
Solved in 3 steps
- Which of the following statements regarding viral genomes is FALSE? Question options: viral genomes are always comprised of RNA viral genomes are smaller than the genomes of cellular life viral genomes can be either single-stranded or double-stranded viruses can have as few as three genes viral genomes do not encode ribosomal RNAs all these statements are TRUE The ______________ of a virus is a phospholipid bilayer with embedded proteins and glycoproteins Question options: capsid chromosome envelope nucleocapsid spike receptorA series of experiments shows that oil content in a diploid grain is influenced by five genes (a through e) with additive alleles. The highest-producing strain has 30o% oil content; the lowest has 10%. A plant of unknown genotype has an oil content of 22%. What is a possible genotype for this plant (+ = additive alleles)? O a+ a+ b+ bccddee O aa b+ b c+c d+ d+ e+ e+ O a+ a+ b+ b+ccddee O a+ a+ b+ b+ c+ c+ d+ de+ e O a+ a+ b+ b+ c+ c+ d+ deeOF rasc PDF Teas fill Which of the following is NOT a step in the replication of a retrovirus? A diagram illustrating the process is provided below. PDF UNOFFIC TRANSCR 59°F Mostly cloudy Virus Viral RNA Reverse transcriptase DDDDDD ↓Viral DNA Provirus mRNA mm Proteins mn Viral RNA Protease Plasma membrane Host DNA New virus O The single-stranded DNA forms a double-stranded DNA called a provirus, which is incorporated into the host cell DNA. O After a retrovirus attaches to the host cell, it injects its viral DNA and uses the host cell's machinery and materials to replicate. O After a retrovirus injects its viral RNA into a host cell, it forms a DNA strand by reverse transcription. O When the host cell replicates, a provirus produces the viral RNA needed to produce more virus particles. P O Search hun recc PDF maste omiss
- Give typed full explanation Suppose a nucleic acid amplification test (for example, a PCR test performed to diagnosis a virus) gives a negative result - what would a "negative" PCR test result specifically mean? Group of answer choices the individual tested was disease-free no DNA amplification was observed no viral DNA was present in the host the target DNA sequence was replicated no RNA was present in the sample testedUse the Internet to search prion diseases, and identify three major differences between a viral disease and a prion disease. please provide a minimum of 500 words. ThanksBelow is the primary sequence of a viral protein. MSVVNTEIKFPTHLRSGDFAIIDGMVVEVTSVEYKPVEQAVYLKYRYHLHGNELSGSSLISAFKAVRTLEVP How many peptide bonds are present in this protein? Please write your answer as a number below.
- What is a virus? How do they differ from other infectious microorganisms? Make sure to explain each difference. Why are viruses difficult infections to fight? Include in your answer what is happening now with Covid-19. Edit View Insert Format Tools Table 12pt v Paragraph v BIUAbout the technique of phage display: MOLECULAR BIOLOGY_advanced The Escherichia coli cell infected by the phage codifies for the optimized ligand when the phage DNA integrates in the DNA of the bacteria. Phages are selected if they express on their surface the optimized ligand. One selects Escherichia coli cells that are resistant to the phage infection. More than one optimized ligand can be selected during the panning procedure. The ligand to be selected on the surface of the phage is non-covalently linked to one of the surface proteins.a typical eukarytic cell has a diameter of 50 microns while a corona virus particles has a diameter of 100 nanometers. how many virus particles could be packed into the volum of the typical eurkaryotic cell? (assume the cell and the virus are spherical - V = 4/3 π R^3 and that the particles can use 100% of the space in the cell)
- Define the difference in the term species for a eukaryotic organism, a prokaryotic cell and a virus. - This is a description of the term “species” not a description of prokaryotic, eukaryotic cells or a viral structure. Please keep this between 2-3 sentencesWhich biological system contains a protein nucleocapsid surrounding 2 antiparallel polynucleotide strands (held together by hydrogen bonds), with deoxyribose sugars, but no ribose sugars? a single-stranded RNA viroid (like avocado sun blotch viroid) a double-stranded RNA virus (like the reovirus family) a single-stranded DNA virus (like fX174 virus of E. coli) a double-stranded DNA virus (like the smallpox virus) a single-stranded RNA virus (like tobacco mosaic virus)Reverse transcriptase would most likely be found in which of the following types of viruses? an RNA-based lytic virus a DNA-based lytic virus an RNA-based lysogenic virus a DNA-based lysogenic virus CO000