7. WHAT IS A PHOSPHODIESTER BOND? WHERE CAN IT BE FOUND? 8. GIVE AT LEAST 10 CARBOXYLIC ACIDS THAT HAVE A SIGNIFICANT ROLE IN BIOLOGICAL SYSTEMS AND/OR IN MEDICINE. 9. WHAT IS DECARBOXYLATION? CITE BIOLOGICAL PROCESSES WHICH INCLUDE DECARBOXYLATION.
Q: From a kinetics experiment, Kcat was determined to be 55sec^-1. For the kinetic assay, 0.05mL of a…
A: The concentration of enzyme stock solution was 0.05mg/ml. i.e. 1ml contain 0.05mg of enzyme. We took…
Q: Problem. The student conducted a chemical experiment to prove the reducing properties of maltose…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: 1. Describe the role of Cys in the catalytic mechanism shown. 2. Describe/predict the…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Which of the following modes of transport across biological membranes is driven by a chemical…
A: The cell membrane is a phospholipid bilayer that allows the passage of small and non polar molecules…
Q: Lactate dehydrogenase (LDH): structure, characteristics, isoforms and their diagnostic significance.
A: Enzymes are bio-catalyst that participate in biochemical process and they are highly specific in…
Q: Vasopressin is a hormone that plays an important role in social behavior, sexual motivation, and…
A: Recall that: Amino acid sequences are written with N-terminal amino acid on the left and…
Q: The absorption of ketoconazole has been shown to be impaired in patients with drug-induced…
A: Achlorhydria is a condition in which there is no HCl in the stomach. Stomach HCl plays important…
Q: 4. Identify: for nos. 1-5: Name of the missing metabolite in the pathway 6-10: Enzyme that catalyzed…
A: Catabolism is the breakdown of complex substances into simpler molecules, while anabolism is the…
Q: single-substrate reaction E+SESE+P.7 nditions: [S] > Km- ent with the condition that it describes.…
A: .
Q: Phosphonacetyl-L-aspartate (PALA) is a potent inhibitor of aspartate transcarbamoylase because it…
A: Enzymes are biocatalysts that catalyse biochemical reactions. They contain an active site where the…
Q: 4. If the standard reduction potential for NAD+ to NADH is -0.320 V at pH 7 and the standard…
A: Biological oxidation-reduction reactions involve the transfer of electrons from one biomolecule,…
Q: Enzymes work by... OA) Altering the equilibrium position of a reaction B) Altering the DG value for…
A: Enzymes are protein molecules that catalyze the biological reaction at mild conditions such as pH…
Q: How many hydrogen bonds exist between this DNA strand and its complementary strand? 5'-GCATAAT-3'
A: Nucleic acids are biomolecules that are essential for all life forms. They are polymers of…
Q: Using proper convention, provide the amino acid sequence for the following protein. _8_#_H²-8-8° CH3…
A: There are twenty standard amino acids that makeup all the peptides and proteins inside the cell.…
Q: What is the sequence of the product of transcription of a DNA strand with the following sequence…
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: 4. What is the sum of all the hydrogens at the highlighted carbon atoms in the given structure? A. 7…
A: The given structure is a hydrocarbon. By balancing the valency of carbon, we can calculate the…
Q: Which of the following is a type of irreversible enzyme inhibitor A) Mechanism-based (suicide)…
A:
Q: Biochemistry Plz answer these 2 question 1. How to differentiate between beta-amylase from alpha…
A: “Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: Briefly explain chymotrypsin with reference to the following: a) Catalytic triad (not the mechanism…
A: DISCLAIMER FOR MULTIPART Since you have posted a question with multiple sub-parts, we will solve…
Q: The primary purpose of the aconitase step in Citric Acid Cycle is to: form the intermediate…
A: The citric acid cycle involves acetyl-CoA oxidation into carbon dioxide and water. The acetyl-CoA…
Q: In 1958, Meselson and Stahl conducted an experiment to determine which of the three proposed methods…
A: Three important experiments contributed to our current understanding of DNA structure and function:…
Q: not all polypeptides form a secondary helical structure, explain why polypeptides containing ser,…
A: Two types of secondary structures are abundant in protein: alpha helix and beta sheets. The alpha…
Q: Which of the following is arranged from least to most in terms of number of sugar units ?…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: 60. During a study of thyroid hormone function, an experimental line of mice is genetically…
A: the thyroid gland malfunctions and doesn't produce enough thyroid hormones: thyroxine and…
Q: Question: 1. Give the Haworth and chair forms for the a and ß anomers of: D-galactose b. D-mannose…
A: Haworth projection is a cyclic representation of monosacharide sugars in the form of pyranoses and…
Q: Draw the substrate and product of each of enzymes below. Make sure to label. a) Phosphopentose…
A: Enzymes are biocatalysts that increases the rate of reactions that take place within life forms.…
Q: How many hydrogen bonds exist between this DNA strand and its complementary strand? 5'-CACGGGG-3'
A: Deoxyribonucleic acid (DNA) is a double stranded polynucleotide coiled around a central axis to form…
Q: Signaling by tyrosine kinase receptors is generally associated with all of the following except: OA)…
A: A hormone is a class of signaling molecules in multicellular organisms that are sent to distant…
Q: Why is cholesterol an important steroid?
A: Steroids are the compounds that consist of three cyclohexane rings and a cyclo pentane ring in…
Q: In biochemistry, what form of iron, ferric or ferrous, is most readily absorbed by the body? What…
A: Iron is a trace element that is essential for the body. Hemoglobin is a protein that transports…
Q: describe the functions of the pentose phosphate pathway. Explain how NADPH functions in biosynthesis…
A: In a cell, glucose 6-phosphate has two possible fates: be oxidised into carbon dioxide and water by…
Q: Draw the fractional binding curve with protein that bind to a molecule of ligand L.
A: A ligand is a molecule that binds to a receptor. The specificity of the ligand varies. One ligand…
Q: There are eight chemical reactions that occur in the citric acid cycle process. The reactions of the…
A: Cellular respiration is the process how biochemical energy is generated from food. It involves the…
Q: 9. The NUDT18 protein was purified by affinity chromatography (Hiss tagged) followed by gel…
A: Affinity chromatography is a method of separating a biomolecule from a mixture, based on its ability…
Q: Calculate the ∆G°' for the complete oxidation of acetate (C2H3O2-) to CO2 by: a) aerobic metabolism…
A: In a general reaction such as: aA + bB ⇌ cC + dD At equilibrium (steady state), the concentration of…
Q: Glycolysis is central to carbohydrate metabolism and is an intergrated part of other carbohydrate…
A: Glycolysis is a collection of 10 enzymatically catalysed reactions that sequentially oxidise a…
Q: Briefly describe the role and location of each cofactor/coenzyme involved in the pyruvate…
A: Pyruvate is the end product of glycolysis. Under aerobic conditions, pyruvate is oxidised into…
Q: 1. Consider the reaction: succinyl-CoA succinate H3C H3C C H₂ a. What kind of reaction is being…
A: Acetyl CoA produced from fatty acid oxidation in the hepatic cells has two possible fates: enter…
Q: Draw the structure of a triacylglycerol containing stearic acid, palmitic acid, and oleic acid.
A: Animal fat and vegetable oil fall into the category of simple fats or triglycerides. Triglycerides…
Q: Orotic aciduria is treated with: ○ Tetrahydrofolate O 5-flourouricil O Uridine supplements O Calcium…
A: Patients suffering from Orotic aciduria have increased levels of orotic acid in their urine.…
Q: In beta-oxidation, which cofactor is required the for second oxidation reaction (conversion of…
A: Fatty acid β-oxidation is the metabolic process by which fatty acids are broken down to produce…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: 1 is there a positive or negative entropy change in the first step of histidine synthesis? 2 how…
A: "Since you have asked multiple questions, we will solve the first three questions for you. If you…
Q: 1. Carbohydrate digestion: gastrointestinal enzymes and the optimal pH environment for their…
A: Carbohydrates are key energy source in our body and basic subunit of carbohydrate is…
Q: Quaternary structure of the protein is possible for Both monomeric and multimeric protein…
A: There are four level of protein structure classification. They are Primary, Secondary, Tertiary and…
Q: The textbook author admits the number of protons pumped from the matrix to inter-membrane space by…
A: Oxidative Phosphorylation: In a sequence of redox reactions, electrons are transferred from one…
Q: In 1971, Dr. Akira Endo, working at the Sankyo company in Tokyo speculated that fungi not only…
A: Since you have posted a question with multiple sub parts, we will provide the solution only to the…
Q: There are eight chemical reactions that occur in the citric acid cycle process. The reactions of…
A: The Krebs cycle or citric acid cycle occurs in the mitochondria and provides electrons for oxidative…
Q: Answer in brief sentences in your own words please thank you! 1. Soon after the bolus reaches the…
A: Starch is a complex carbohydrate. Starch digestion starts in the mouth but occurs mostly in the…
Q: Provide the name of the following nitrogen-containing heterocyclic base.
A: DNA/RNA are nucleic acids, the molecules responsible for carrying genetic information from one…
7. WHAT IS A PHOSPHODIESTER
BOND? WHERE CAN IT BE FOUND?
8. GIVE AT LEAST 10
HAVE A SIGNIFICANT ROLE IN BIOLOGICAL
SYSTEMS AND/OR IN MEDICINE.
9. WHAT IS DECARBOXYLATION? CITE BIOLOGICAL PROCESSES
WHICH INCLUDE DECARBOXYLATION.
Step by step
Solved in 2 steps
- 1. An oligosaccharide is a repeating unit of a-D-galactopyranosyl- (a-1- 3)-allopyranoside. Each of the disaccharide unit is linked via B-1-->4 glycosidic bond. Identify and draw the molecular structure. Identify and draw the structure. The oligosaccharide has 10 monosaccharide residue a. Upon the action of alpha-glycosidase, identify and draw all the possible products. b. What is the L-isomer of the Fisher projection of one epimer of D-allopyronoside. Draw the structure. Why is this an epimer of the monosaccharide? c. Is this saccharide a good substrate for glycolysis? Why or why not?6. b. Draw a box around the disulfide bridge in oxytocin, if present, or write "none". 7. Mark each peptide bond in oxytocin by making the corresponding line in the structure thicker or marking it with a different color. The first one is shown for you as an example (in dark orange). 8. Number the central carbon of each amino acid in oxytocin by pointing a small arrow to it or by circling the corresponding vertex in the image. Numbers 1 and 2 indicate the central carbons of the first and second amino acids of oxytocin, and are shown for you as an example. 9. Fill out the following table, listing amino acids that make up oxytocin in order, from the N terminus to the C terminus, characterizing each amino acid by the properties of its R group (side chains), and briefly indicating the reasoning for the characterization. You may consult amino acid groupings by category in the slides (or the textbook, p.49), but you must explain the reasoning for each in your own words. CO 1 AA# Abbre- Full…6. Identify the following functional groups AND provide an example of one biomolecule containing that functional group. A B C D E Chemical formula - PO, - COH -OH -COOH -NH₂ Structural formula O -O-P-0° 0= 0- N H -OH C=O OH H H Example: Example: Example: Example: Example: Riomolecules:
- 11. List 2 polysaccharides that provide structure and strength. What is interesting about the orientation/shape/bonding/architecture in these molecules?7. Hydrogen bonds are a crucial component of biomolecular structure and biomolecular interactions. In the following drawings, draw in several hydrogen bonds that are possible between atoms within the same molecule or between different molecules: A: Protein structure H₂C₁ #1 N-H N-C 0=C HR 1 N-H ORU 0=C N-HH-CR B: DNA base-pairing H H-N N-H N=C C-C H 0=C NIH C C=N HR 0=3₁ HR H-9-4 0-0 NIH N-H 0=C 0=0 RECH N-H N-H 0=8-₁ OH HR C: Plant cell wall (cellulose) CH₂OH H BỆNH O=C HA CH OH H CH₂OH ( он H HC-0 CH₂₂OH H OH 1 TH OH H IN HC- OH H CH₂OH CH₂₂OH O OH H C-CH H bH CH₂₂OH VA HS COK H ОН Biomolecules like DNA, proteins, and carbohydrates depend on hydrogen bonds to maintain their overall structure. However, each individual hydrogen bond is relatively weak. Using protein structure from the question above as an example, explain how to resolve the apparent contradiction between these two statements.Organic Molecules and Carbohydrates How many covalent bonds are formed by one carbon, and why? When a double covalent bond is formed, how many electrons are being shared? 3. Given a molecule that was drawn incorrectly, indicate which carbon does not have a sufficient number of bonds. 1. 2. Given a molecular formula (such as CH4) identify the molecule as inorganic or organic. 5. Given an organic molecule (molecular or structural formula) indicate whether the molecule is hydrophobic or hydrophilic and why. 6. Given two molecules, identify whether they are isomers of each other and explain why. 7. Explain the importance of functional groups. Be able to identify and name all functional groups. Define and explain the relationship of the following words: macromolecule, monomer, dimer and polymer. 9. Describe the chemical reactions of dehydration synthesis and hydrolysis in terms of what occurs, and what is accomplished. (Which can bond together monomers? Which splits a dimer or polymer into…
- 2. Two amino acids are shown below. Name them in the blanks, and then draw the structure of the dipeptide they would form if a peptide bond connected them (in the order shown.) Draw the dipeptide as a Zwitterion, and name it in the blank. H3N-CH- CH-C-O CH3 + + H3N-CH₂-C O6. Peptide bonds link many amino acids into chains of subunits that make polypeptides, or proteins. In the space below, or on a blank sheet of paper, draw the dehydration synthesis reaction showing the peptide bond that forms between two alanine (C3H;NO2) amino acids. Remember that all amino acids have an amino functional group at one end (N-terminal end) and a carboxyl functional group at the other end (C-terminal end). Also, alanine is an amino acid that has a CH3 off the middle ("R" group) carbon.1. Make a series (at least 3) of drawings to show the three dehydration synthesis reactions that take place between the two Fatty Acids, the Phosphate Head and the Glycerol. Show the water molecules made. a) Label the following on the completed phospholipid: hydrophilic and hydrophobic parts of the molecule, fatty acids, phosphate group, and glycerol. b) Compare the structure of the phospholipid to that of a triglyceride. How are the two molecules Similar? How are they different? 2. Use the following vocabulary to label and draw a cell membrane: cytoplasm (cell lumen) extra-cellular fluid hydrophobic hydrophilic polar head non-polar tails a) How many O-H groups are there? And are the O-H areas of sucrose polar or non-polar? b) What is the term that is used to discuss how tightly or loosely an atom's nucleus has a hold of its valence electrons?
- 1. a. Draw the following pentapeptide: lysine-leucine-aspartate-threonine-phenylalanine b. Label the amino and carboxyl terminus of your peptide c. Label each amino acid residue with one and three letter abbreviations d. Label the alpha carbons e. Label the bonds around which phi and psi rotational angles occur f. Which amino acid in this chain is most likely to be phosphorylated? Which amino acid is most likely to be acetylated?10. List 2 polysaccharides that are used for energy storage. What is interesting about the orientation/shape/bonding/architecture in these molecules?1. What is the chemical formula for palmitic acid and oleic acid? Which one is a saturated fat and which one is an unsaturated fat? How do you know? 2. What functional groups are involved in dehydration synthesis reactions to form a triglyceride? What is the waste product? 3. Compare the overall acidity of the molecules before and after the formation of a triglyceride. Proteins 1. What gives each amino R group its key characteristics to make it polar, non-polar, or ionic? 2. What functional groups are involved in dehydration synthesis? 3. How might the solubility of peptides be influenced by the size of the peptides? How might the R group of the amino acid influence it? 4. Would you consider the formation of a peptide bond to be an example of a neutralization reaction? Explain your reasoning.