what is the correct way of drawing a peptide backbone?
Q: What is the corresponding RNA sequence, if the DNA sequence reads TACACCTGG?
A: The RNA or ribonucleic acid is single stranded macromolecule that is composed of nucleotides. RNA is…
Q: omplete what is being asked and finally with the Genetic Code table, determine what specific amino…
A: Biological macromolecules are those large molecules that are necessary for the survival and growth…
Q: What is the resulting polypeptide: _______________________________________________________? What…
A: Mutation in a gene sequence causes encoding of a mutated protein. This mutated protein will have…
Q: What amino acid sequence is encoded by the codon sequence ACGCAGCGCCCGGUC? Use the 3 letter…
A: The amino acids are produced by the help of ribosome in the process of translation. In this process…
Q: what is the amino acid squence of the protein?
A: Amino acids are organic compounds that serve as the building blocks of proteins. They play a crucial…
Q: Illustrate the titration curve of the peptide with the given sequence below. Show the pKas,…
A: The given peptide is composed of eight amino acids attached together via peptide bonds. All the…
Q: Can you please help me how to draw tripeptide ile-leu-arg and indicate the torsion angles phi and…
A: Amino acids are organic acids that contain both carboxylic acid group as well as amine groups. The…
Q: Using proper convention, provide the amino acid sequence for the following protein. _8_#_H²-8-8° CH3…
A: There are twenty standard amino acids that makeup all the peptides and proteins inside the cell.…
Q: Write the consensus sequence for the following set of nucleotide sequences. AGGAGTT AGCTATT TGCAATA…
A: Genes are the structural and functional units of heredity. They carry coded genetic information in…
Q: Sir Bong wanted to determine the a amino acide sequence og BONG. The summary of the analyses…
A: Since you have posted a question with multiple sub-parts, we will solve first three subparts for…
Q: Aspartate and phenyalanine become apartate and isoleucine
A:
Q: Can you show me the step how you get the amino acid sequence?
A: An amino acid sequence refers to the linear arrangement of amino acids in a protein or peptide.…
Q: 1. Given the structure below, give the complete name of the following peptide: H,N. N. N. N. .COOH…
A: Amino acids are the molecules that join to form a protein structure. The bond formed between two…
Q: 1) What DNA base sequence is complementary to the following DNA sequence? TAGCGTGCATGGTGCTTAAC 2)…
A: Introduction: DNA stands for 'deoxyribonucleic acid' and it is the hereditary material in humans and…
Q: Which isomer- (R)-arginine or (S)-arginine is D-arginine? O (R)-arginine O (S)-arginine Submit…
A: Isomers are molecules with same molecular formula and different arrangement of atoms. Enantiomers…
Q: Consider the following coding 71 nucleotide DNA template sequence (It does not contain a…
A: In cell protein formed according to the sequence on mRNA. mRNA is formed from DNA sequence by the…
Q: Name Lysine Arginine Histidine Aspartate Glutamate Structure 1-Let Abbr 3-Let Abbr Class Special…
A: Amino acids are organic compounds that form the building blocks of proteins in cells. The structure…
Q: Please help me make an abstract using the information below it is the result and discussion of the…
A: DNA i.e. Deoxyribose nucleotide : It consists of nitrogen bases i.e. Adenine , Guanine , Cytosine…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: what are 20 different amino acid names explain each of them and explain their 3 letter dimention,1…
A: Biochemistry is a branch of biology that mostly deals with the structure, function, and interaction…
Q: Part of being a detective is being able to decode secret messages left behind by certain…
A: The given DNA sequence is: 5'- TATGCTAGGCATTGTCGTAGGCATACG -3' 3'- ATACGATCCGTAACAGCATCCGTATGC -5'
Q: Which of the following statements about DNA and RNA is CORRECT? Select an answer and submit. For…
A: Nucleic acids are polymeric molecules with a long chain. The monomer or repeating unit is known as a…
Q: What is the nucleotide sequence of the complementary strand of the DNA molecule:…
A: Nucleic acids are large macromolecules that store hereditary information for cellular growth and…
Q: Hello , please help me with this question. I am struggling with naming the Amino Acid sequence from…
A: Codon is the triplet of either DNA or RNA nucleotides which codes for a specific amino acid during…
Q: Ôn the space provided, type the translation product of wild-type gene A (use three- letter…
A:
Q: Shown below is a portion of a DNA sequence ( 31 base pairs long ) that encodes the last amino acids…
A: The process of synthesis of messenger RNA with the help of template DNA strand is called…
Q: How many amino acids are in the following peptide? H₂N H3C ZI CH3 IZ O=C CH3 `N H HH OH | LOH
A: A polypeptide chain constitutes of amino acids are linked together via peptide bonds. The proteins…
Q: Choose a pentapeptied composed of five different amino acids. List the five amino acids.…
A: mRNA strand is synthesized from the template strand of the DNA by transcription. This mRNA is…
Q: A NONAPEPTIDE that attacks and kills cancer cells has just been recently isolated from a rare…
A: DNA sequencing is a biochemical method for determining the order of the nucleotide bases, adenine,…
Q: How many possible nucleotide sequences could code for a peptide with the sequence "MRRTGERS*"? (Note…
A: The given sequence is 'MRRTGERS*'. The amino acid sequence is…
Q: What to submit: Draw in the hydrogen bonds for parallel and antiparallel sheets and replace the…
A: The proteins are a major class of biological macromolecules that are composed of amino acids…
Q: e a You must make a peptide using four amino acids (these are assigned using the three letter amino…
A: Amino acid is the monomer of protein. Amino acids are bonded together by a peptide bond to form a…
Q: Identify the name of the amino acid and its group (aliphatic, aromatic, acidic, basic, hydroxylic,…
A: A biomolecule is a carbon-based organic compound that is produced by a living organism. Amino acids…
Q: Predict the amino acid sequence based on the conditions below. Use the one-letter abbreviation of…
A: Amino acids are building block of polypeptide chain. its alpha carbon contains carboxyl group, amine…
Q: When answering the questions below, please use the ONE-LETTER CODE for the amino acid, with NO…
A: The determination of primary structure of a protein is crucial since the sequence of the protein…
Q: Give the amino acid sequence with some little explanation please. 5′…
A: Decoding a sequence of bases in mRNA results in the formation of either peptide, polypeptide, or…
Q: 1. What is the N-terminal AA residue? 2. What is the C-terminal AA residue? 3. What is the sequence…
A: Aminoacids are organic compunds. that combine to form protein. Amino acid is formed when a central…
Q: Reaction of the α-carboxyl group of an amino acid or peptide with phenylisothiocyanate allows for…
A: Above statement is about Edman degradation. It ia a method of DNA sequencing.
Q: A solution of a peptide of unknown sequence was divided into two samples. One sample was treated…
A: Only twenty of the available amino acids are often present in proteins among all the possible amino…
Q: Identify the type of mutation present in the CDS and discuss the implications on the protein.
A: Mutations are random alteration in the DNA structure which leads to mis-reading of Information on…
Q: How do you translate this into amino acid sequence
A: The process of synthesis of protein with the help of messenger RNA is called translation. In the…
Q: The peptide below 요 H3N-CH- -NH- -CH- NH–CH=C -NH-CH-C NH–CH- C-OH CH3 CH2 CH2 CH2 CH HO-CH, CH2 C…
A: Peptides are produced from amino acids. The pH of the medium and the amino acid sequence determine a…
Q: What would be the percentage of G, C, A, and T in each column? Have to calculate the nucleotide…
A: Nucleotide frequency is the percentage of each nucleotide (G, C, A, and T) in a DNA or RNA sequence.…
Q: Choose any pentapeptide composed of five different amino acids. List the amino acids. Present the…
A: A pentapeptide is a chain of five amino acids connected together via a peptide bond. A protein chain…
what is the correct way of drawing a peptide backbone?
please answer clearly
Step by step
Solved in 3 steps with 4 images
- Using the genetic code, interpret the following set of nucleotides. AUGGGUCCAUGGCGUAGGCCAAAUGAUGAGGAAUGAThe sequence of a polypeptide is determined by the order of codons that specify the amino acids in the polypeptide. How many different sequences of codons can specify the polypeptide sequence methionine-histidine-lysine? (Use the table to find the number of possibilities.) SECOND BASE UAU UACFTyrosine (Tyr) UAA -Stop codon UAG -Stop codon UUUL UGU Cysteine (Cys) UCU uc UCA FSerine (Ser) uca Uuc Phenylalanine (Phe) UUAL Leucine (Leu) CAU CAC CAA Glutamine (Gin) CAGF UGA -Stop codon uaa -Tryptophan (Trp) CGU сос CGA FArginine (Arg) CU CU Histidine (His) CuA FLeucine (Leu) Cua) Proline (Pro) CCA cca AAU Asparagine (Asn) AGU Serine (Ser) AGC AUU ACU ACC Threonine (Thr) AACF AAA AAGLysine (Lys) AUC Fisoleucine (lle) AUA Methionine (Met) AUG - Start codon ACA ACG AGA AGGFArginine (Arg) GU GACAspartic acid (Asp) GGA GAA Glutamic acid (Glu) Gaa) GcU -Valine (Val) G GUA GCA FAlanine (Ala) Glycine (Gly) 8. 1 4 THIRD BASE 2. FIRST BASEThe codon chart is shown below, what amino acid sequence does the DNA sequence: 3' TCAGCTAGA 5' code for?
- Given below are sequences of amino acids present in an oligo-peptide chain. Count the overall charge of each assigned peptide and write it in your answer. Along with it also mention that toward which electrode (cathode or anode) will the peptide move? Please remember that cathode is a negativeelectrode and anode is a positive electrode. Ile-Lys-Arg-Trp-Lys-Asn-Glu-His-Pro-Asp-Ala-Tyr-Phe-Glu-Met-Phe-Gly-ValTranslate to amino acids the strand using the Genetic Code chart. Remember to use the start and stop sequences. UGCGAUGGCAAUCGGUGUACCCCUGACUGAGC1) You are studying the toxic protein called ectatomin, a major component of ant venom (specifically from the species Ectatomma tuberculatum), that embeds into cell membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer, meaning the protein is comprised of two polypeptides; the sequences of the two polypeptides are given in the table with single-letter abbreviations. polypeptide sequences of ectatomin monomers polypeptide |protein sequence polypeptide 1 GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL polypeptide 2 WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280nm? Select the best answer. a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate than measuring absorbance at 280nm. b) The Bradford…
- Enumerate all the possible DNA nucleotide base sequence for the amino acids given.Part of a sequence of DNA from a person without this genetic disease is: TAG TAA AAA CCA CCC AGG Part of a sequence of DNA from a person with a genetic disease is: TAG TAA CCA CCC AGG The possible codons for some amino acids are shown in the table. Amino acid Codons glycine GGU GGC GGA GGG isoleucine AUU AUC phenylalanine UUU UUC serine UCU UCC UCA UCG Which amino acid is missing from a person with this genetic disease? serine glycine O phenylalanine isoleucineDO NOT COPY OLDER ANSWERS! AND SHOW FULL WORK! I have a mixture of 4 proteins, whose sequences are shown below (note that each protein is a 100-repeat of the sequence shown). Protein A: (Gly-Ala-Lys-Val-Ile-Phe-Glu-Val-Asn-Gly) Protein B: (Ala-Ala-Lys-Arg-Ile-His-Glu-Ala-Asn-Lys) Protein C: (Glu-Val-His-Asp-Ala-Asp-Glu-Val-Asn-Asp) Protein D: (Ala-Lys-Arg-Phe-Trp-Phe-Gly-Ile-Ala-Gly) 1) Which protein/s are MOST LIKELY to precipitate out at a pH of 3.5? a) A b) B c) C d) D e) B & C f) A & D g) None of them h) Cannot be determined.
- What can be the interpretation for the results given below? Test/s Results Ninhydrin Xanthroproteic Millon's + Biuret Pauly O The unknown sample contains tyrosine and tryptophan residues O The unknown sample only contains tyrosine as free amino acids The unknown sample contains tyrosine and histidine residues O The unknown sample contains tyrosine, tryptophan, and histidine residuesStructure and Nomenclature Name the second complementary base from the 5' direction. USE ALL CAPITAL LETTERS ONLY. Name the second complementary base from the 3' direction. USE ALL CAPITAL LETTERS ONLY. NH, NH2 O OH 0=P- NH NH: NH, NH: OH OH O-P-o- OH OH 0=P-O- OH OH 1:44 pm O Type here to search G 4) ENG 11/10/2021 14Create protein sequence with 10 amino acids