(A) + GTP - GTP Ran Ran importin 00 importin

In the absence of tension, MscL channel has an energy gap separating the closed and open states Eo = 50 kT. MscL opening is associated with a 20 nm2 in-plane protein expansion (change in A). Plot its open probability (Po) as a function of membrane tension. What will be the open probabilities of two MscL channels if one situates at the pole of the bacterial cell above, another in the middle?

What type of signal sequence(s) would be used to create the ACE2 (type 1) integral membrane protein?

If you did a classic Pulse-Chase experiment to follow the path of a secreted protein, and you forgot to do the Chase, which of the following would you observe?     No radioactivity would be seen in any of the structures.     Radioactivity would increase first in rough ER, then Golgi Complex, then secretory vesicles, but it would remain high in all, never decreasing.     Nothing would change     Radioactivity would increase in all 3 structures simultaneously and stay high.

Ran is a major player in the process of nucleocytoplasmic transport via the nuclear pore. Because net Ran movement simply follows a concentration gradient, what maintains the Ran gradient across the nuclear membrane? Options:   the concentration levels of cargo in the nucleus to be exported   GTP concentrations in the nucleus   the correct positioning of the GEF and GAP with respect to the nuclear envelope   the interaction of exportin and importin with their cognate substrates   none of the above

Determine how many domains and list the residues in each domains (ei. 1-230, 1-120) Vertebrate Ca 2+ -dependent cell adhesion protein (4VCA): Proteobacterial DNA topoisomerase subunit (5PDT): Vertebrate cell receptor (6VCR)

Why is the structure of the plasma membrane considered to be a fluid-mosaic model?

1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 - +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an…