Tube# 2 3 5 7 8 PGLO PGLO PGLO DNA PARO180 PARO180 Green Green Blue PGLO Non-F pGLO non- F λ (Lambda) ng DNA unknown unknown unknown unknown unknown unknown unknown 500 ng Enzyme Pvul Sspl Pvul Sspl Sspl Pvul Sspl Hind Ill Water Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι PARO180 Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι DNA PGLO Green Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι PGLO Blue Ο μι Ο μι Ο μί Ο μι Ο μι Ο μι Ο μι PGLO Non-F Ο μι Ο μι Ο μι Ο μι 0 μ. Ο μι λ DNA Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Anza Buffer Ο μι Ο μι Ο μι Ο μι Ο μι Tango Buffer Ο μι Ο μι Ο μι Ο μι 2.1 Buffer Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Sspl Ο μι 0.4 μ. Ο μι 0.4 μ. 0.4 μ. Ο μι 0.4 μ. Ο μι Pvul 0.4 μ. Ο μι 0.4 μ. Ο μι Ο μι 0.4 μ. Ο μι Ο μι Hind Ill Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Ο μι Total 25 μΙ 25 μΙ 25 μΙ 25 μΙ 25 μΙ 25 μΙ 25 μΙ 25 μΙ volume
Q: Many cases of drug overdose involve which of the following? the taking of the…
A: The question is asking about the common factors involved in many cases of drug overdose. Drug…
Q: THINK ABOUT IT- Look at the food web below and answer the questions. FIGURE 6.3 Food webs: (a) a…
A: Food webs show intricate relationships that sustain life within various ecosystems, showcasing the…
Q: The adaptation planning process draws on broad principles of the ecosystem approach to fisheries…
A: The objective of the question is to identify which of the given options are not balanced through…
Q: An example of a sustainable agriculture practice is _______. a. widespread use of…
A: The objective of the question is to identify which of the given options represents a sustainable…
Q: The new classification of the 3 Domains of life is based on: a) comparisons of the ribosome b)…
A: The objective of the question is to identify the basis for the new classification of the three…
Q: that hydrolysis of ADP cell respiration formation of ATP releases is an endergonic process free…
A: Approach to solving the question:Endergonic reaction absorbs free energy (positive change in free…
Q: 5. True or False: The goal of using the hand under hand technique is to perform the task for the…
A: Answer well explained above
Q: both parants are doominat tall name 4 possible offspring?
A: The question is asking for the possible offspring of two parents who are both dominant tall. In…
Q: What enabled modern humans to colonize the world? Explain what Dan Lieberman means by "Brains and…
A: Approach to solving the question: I hope I was able to help you in elaborating on the topic. feel…
Q: Forensics Q3
A: 1. **Offspring who cannot be the offspring of Tom (assuming a typo in the provided data corrected…
Q: Neanderthals used projectile weapons. True or false
A: The question is asking whether Neanderthals, an extinct species of archaic humans who lived in…
Q: Meiosis:
A: MEIOSISBEFORE MEIOSISInterphaseDNA is replicatedMEIOSIS IProphase ISynapses occurs; crossing over…
Q: Consider the audibility curves in the graph above. Suppose all animals listed in the graph are…
A: So, the correct statements appear to be: C. A sound of 10,000 Hz would need greater amplitude than…
Q: A child with Type O blood is born to a mother with Type B blood. What is the genotype of the child?…
A: The child has type O blood because they inherit two "O" genes, one from each parent. The mother has…
Q: Strepsirrhines differ from haplorrhines in retaining more ancestral traits from the earliest…
A: The question is asking whether Strepsirrhines, a suborder of primates, retain more ancestral traits…
Q: During a routine exam, Jessica has some blood taken and analyzed. The results show a high IgM titer…
A: IgM and IgG Antibodies:The body produces antibodies to start an immune response in response to…
Q: ) A cyclic exposure of a liquid to heat and cold defines: a) Sterilization b) Disinfection c)…
A: The question is asking to identify the process that involves cyclic exposure of a liquid to heat and…
Q: Why are contaminants such as TCE (trichloroethylene) and PCB (polychlorinated biphenyls) so…
A: The most difficult aspect of removing TCE and PCBs is:They easily adsorb onto organic matter in the…
Q: 4. Which is an important tip to follow when toileting a person with Alzheimer’s disease?…
A: A. Providing Easy-to-Remove Clothing (Best Choice):• Dignity and Independence: People with…
Q: True or false: all protists have a nucleus
A: The question is asking whether all protists, a diverse group of eukaryotic microorganisms, have a…
Q: You cross a fruit fly with long wings (L) to one with short wings (l), and out of over 100…
A: Solution:Determining the Genotypes of the ParentsTo determine the genotypes of the parents, we can…
Q: I need three paragraphs
A: In the thrilling adventure of survival at the secret location, I found myself surrounded by an…
Q: 3. Which of the following best describes retaliation for a claim of harassment? An action taken…
A: An action taken by a harassment victim against the harasser - This option is incorrect because…
Q: I need help with this question please
A: During the G1 phase of the cell cycle, Cyclin-Dependent Kinase (CDK) complexes prepare for the…
Q: Biomedical Engineering: An equilibrium dialysis experiment was performed to characterize the binding…
A: Association constant of :Mouse Ig G = 4.75 × 108 M-1Human Ig G = 1.3 × 1010 M-1 a) Dissociation…
Q: Which statement is NOT true about the early hominins: A) The angle of the foramen magnum on…
A: The objective of the question is to identify the statement that is not true about the early…
Q: make a pathophysiology flow chart of Upper Respiratory Tract Infection with a data of: 3 months old…
A: Introduction to Upper Respiratory Tract Infection (URTI):Upper Respiratory Tract Infection (URTI)…
Q: Drag and drop from the available list of terms. The synthesis of complex molecules is reaction,…
A: The building of complex molecules, such as sugars, from simpler ones is an anabolic process and is…
Q: I need help please can you red through the links (3) and find somthing very intresting to someone…
A: Interesting Facts about Oropharyngeal Cancer:Link 1:…
Q: step by step calculations please
A: 1) Step 1: 1 ng = 0.001 µg Step 2: 200 ng = 200 * 0.001 = 0.2 µg 2) Step 1: 1 µg/ml = 0.001…
Q: What are the subsectors of the fisheries and aquaculture sector? Select two or more:…
A: The question is asking to identify the subsectors of the fisheries and aquaculture sector. The…
Q: Forensics Q1
A: In this scenario, the DNA gel analysis reveals genetic markers that are shared between both the wife…
Q: 5'....TACTGCCCATGCCCAGAGAGAAAGCGCAGACGCGTCTAA actgt... 3' a). (10 points). In the above sequences,…
A: Answer:a) Wildtype Amino Acid Sequences:i) Wildtype AA sequence for the region around mutation #1:To…
Q: Describe how a cell fires an action potential and be sure to address which structures are involved…
A: Peer-Reviewed ReferencesBean, B. P. (2007). The action potential in mammalian central neurons.…
Q: Which of the following statements about heterochromatin is FALSE? It contains…
A: The false statement from the given choices is:Histone proteins in heterochromatin are heavily…
Q: For question 1 what the answer And answer question 4 Please is Antro Answer it now
A: Approach to solving the question: used the image in answering the question Detailed explanation:…
Q: Which of the following media is capable of detecting all clinically significant antibodies while…
A: The question is asking us to identify the medium that can detect all clinically significant…
Q: Name at least three viruses most likely to be transmitted by vaccination needles, acupuncture tools…
A: It's important to note that the risk of transmission for these viruses through medical instruments…
Q: Provide one example by which dysregulation of the oxytocin system may affect mental health wellbeing
A: Social anxiety disorder (SAD) is a prevalent mental health condition characterized by intense fear…
Q: Submission Questions A) Explain how the structure of an enzyme makes that enzyme specific? B)…
A: Q. B answerMetabolic pathways can shift in different directions, either reversed or forwarded, based…
Q: Urgently needed
A: A) Allele FrequenciesTotal Rabbits (N) = 150Homozygous Dominant (WW) = 100Heterozygous (Ww) =…
Q: Please anser the last one
A: The adhesin intimin produced by enteropathogenic E. coli (EPEC) is known to cause a characteristic…
Q: Do you think the current conversation about abortion makes good arguments? If so, what is…
A: I hope these suggestions and recommendations help you with your assigned tasks. Have a great day…
Q: make a pathophysiology flow chart of Upper Respiratory Tract Infection with a data of: 3 months old…
A: The objective of this question is to create a pathophysiology flow chart for an Upper Respiratory…
Q: Modify the structure of cysteine
A: In amino acids, the ionizable groups are deprotonated beyond their pKa values. Since the pH values…
Q: Lactic acid is a biproduct formed at the end of anaerobic respiration. This molecule is dangerous to…
A: Approach to solving the question: I hope this helps! Detailed explanation: Examples: Key references:
Q: Define the term persecuted species. Describe at least three persecuted species that live in the…
A: Detailed explanation:Gray Wolf (Canis lupus):The gray wolf was historically widespread throughout…
Q: About adaptation plans, which of the following sentences are NOT true? Select two or more: In…
A: The objective of the question is to identify the statements that are not true regarding adaptation…
Q: Elephants Manatees Hyraxes Tapirs Rhinoceroses Horses Cetaceans Hippopotamuses Ruminants Pigs…
A: To solve this question, you can use a cladogram or phylogenetic tree that illustrates the…
Q: make a pathophysiology flow chart of Upper Respiratory Tract Infection with a data of: 3 months old…
A: The objective of this question is to understand the pathophysiology of an Upper Respiratory Tract…
step by step calculations please
Step by step
Solved in 2 steps
- A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine ThreonineOriginal DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGCTAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT Write the amino acid sequence of the protein that would be formed by translating this plece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids, Use the abbrevlation of the amino adid exactly as Itswritten in the table (including the appropriate capltalizations For example it your answer for amino acid 1 is"Methionine" you would write MET in the box (not Met or met) Second Later UUU UUUC Phe UCU UAU Ser UAC UAA UAG Tyr UGU Cys U Leu UCA ucG UGC Stop uGA Beop UUG Step UGG Trp G Cuu C cuC CUA CUG CU Leu Coc CCA CG CAU Pro cGu CAC CAA CAG His CGC Arg CGA CGG 1st 3rd letter AUU A AUG AUA AUG ACU le AAU AAC AGU ACC Asn Ser U leBer ACC ACA Mct ACG The AAA AAG ACA Lys AGG Arg acu Val GCC GCA GCG GAU GAC GAA GAG GOU GGC GGA GGG Arp G GUC GUA GUG Ala Gly Glu Seovence of the protein, 1st amino acid. 2nd arnino acid: 3rd amino acid: 4th amino acid Sth amino acid: 6th amino acid: 7th amino…
- Word AaBbCcI AaBb CcD AaB AaBbCсI AaBbCcL 4 1 Normal Subtitle Title 1 No Spaci... Subtle Em..... Create and Share Adobe PDF Styles Adobe Acro P 1 1 2 4 A 3. A AL T L 4 E 5 E Question 6: The largest chromosome in Mischievous gremlinus has a length of 9 x 107 base pairs. The rate of DNA synthesis is 3,000 bp per minute at each replication fork. a. How long does it take to replicate the entire chromosome from a single origin of replication located exactly in the middle of the chromosome? Assume no pauses. I b. Experiments performed by Professor Trink reveal that it takes only 20 minutes for a growing cell to replicate this chromosome. What is the minimum number of replicons present on the chromosome? Florian Fischer Find v Replace Select Editing 153 23134 LABORATORY Size of the Cell U22T RAJUBAV RO OJA Shape of the Nucleus 916 91032 Degree of Chromatin Condensation Presence or Absence of Nucleoli Cytoplasmic Staining Blood Cells Presence of Cytoplasmic Granules Cytologic/Histologie 18: or cellule Bone Marrow Cells of the develo eveloping cells noil Identi 0106. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…
- 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…wol for Frayon Elolog - Meet - cha-gX-m sc Jupiter Ed G Which orgerell= A sample of DNA is collected from an organism. It is analyzed and determined that 20% of the DNA is made up of the base adenine. Based on this information, which of the following correctly lists the amounts of the three. remaining bases for this sample? 10% cytosine, 30% thymine, 40% guanine O 20% cytosine, 20% thymine, 20% guanine 30% cytosine, 30% thymine, 20% guanine 30% cytosine, 20% thymine, 30% guanine p. 5 of 31patibility Mode] UE Layout References Mailings Review View A A Aa vA 前、一间刷 一| T AaBbCcDdE AaBE x A Av X, Normal No Spacing Headi co Edit and Save Start your free one month trial of Microsoft 365 or sign in to activate an existing subscription. 9. In human beings, the gene for red-green colorblindness (r) is sex-linked and recessive to its allele for normal vision (R), while the gene for freckles (F) is autosomal and dominant over its allele for nonfreckled (f). A nonfreckled, normal-visioned woman whose father was freckled and colorblind, marries a freckled, colorblind man whose mother was nonfreckled. a. What is the genotype of the woman's father? b. What is the probability that the couple's first child will be a non-freckled, normal visioned girl c. What is the probability that the first two children born to the couple will be freckled and colorblind girls? d. What is the probability that the first child born to the couple will either be a freckled, colorblind boy or a non-freckled,…
- Numbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________EcoRI --- 5' G - AATTC 3' 5' AGAATTCCGACGTATTAGAATTCTTAT CCGCCGCCGGAATTCT CATCA 3' 3' TCTTAAGGCTGCATAATCTTAAGAATAGGCGGCGGCCTTAAGAGTAGT 5' Number of pieces of DNA , and type of fragment .