Identify the ligand that bind to uniprotkb-P39086, the type of allostery, and describe the general function of the protein
Q: What percentage of ATP energy is produced when 9.0 moles of glucose are oxidized into acetyl CoA?…
A: Glycolysis generates net ATP = 2 ATP per mole of Glucose molecule Then end product of glycolysis -…
Q: Which of the following statements about G proteins is correct? O A. G proteins bind hormones. O B. G…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: a) what hormone is high scereted in this condition?
A: Insulin
Q: Write the saponification reaction of the following triglyceride with NaOH Н-С-О CH3 H-C-O- `CH3…
A: Triglycerides, also known as fat molecules, are composed of long chains of fat. In the presence of…
Q: Which statements are associated with positively cooperative oxygen binding of a protein? A. The…
A: Haemoglobin is a tetrameric protein. It is a heterotetramer consisting of two alpha subunits and two…
Q: Please describe the protein purification process with the aim of purifying a protein which locates…
A: We will answer the first question since the exact one was not specified. Please submit a new…
Q: opinion should be the definite characteristic
A: Life of any organism can be beneficial or harmful depends upon the nature of an organism.
Q: list ALL redox reactions that occur during cellular respiration. At the end of your list, how many…
A: Redox reactions involve many reactions from cellular respiration, in which electrons are passed from…
Q: A drug was developed to inhibit the electron transport chain. How many ATP(s) would be generated by…
A: Metabolism includes biosynthesis/ reduction (an anabolic process) and oxidation (catabolic…
Q: 2. Phenothiazine derivatives (chlorpromazine, propazine, triftazine, etc.). Relationship between…
A: Phenothiazines are neuroleptic sellers that affect a selection of receptors along with dopaminergic…
Q: What forces contribute to the folding of a polypeptide? Can you explain the reasoning too?
A: The folding of a protein into its proper three dimensional structure is necessary for attaining the…
Q: In your own words, discuss the phenomena occur during the resting state and active state until the…
A: Neurons are the basic structures and functional units of the nervous system. The axon or the nerve…
Q: Which of the following components are found in lipoproteins? Choose all that apply a. DNA b.…
A: Lipoproteins are essential components of the body that transport nutrients around. Lipoproteins are…
Q: What is the MAJOR product of the reaction catalyzed by rubisco in the Calvin cycle? Select one:
A: The Calvin Cycle is the part of the light independent reactions of photosynthesis, that widely uses…
Q: Which of the following enzyme(s) is/are present in liver cells? () Glycogen phosphorylase (ii)…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: Draw the complementary DNA strand for the given: 5'-A-T-C-C-G-A-A-T-T-G-3' Draw the complementary…
A: Let us first understand the one letter codes for the given nucleotides: A is Adenine T is Thymine…
Q: carbohydrate
A: Osazone test is the chemical test used to detect reducing sugars & this test allows the…
Q: Question Which of the following activities of DNA pol lis MOST important in proofreading A 5' to 3'…
A: The DNA replication in the newly added base are read by DNA pol I enzyme to check weather the added…
Q: 30. assicuatuib if 2alpha and 2 beta chains to form adult hemoglobin
A: HbA2 is a gene that in encodes for the alpha globin chain of haemoglobin in humans.
Q: Nucleotides in the "plus" direction are said to lie ____ the transcription start site. positive…
A: Transcription start site:- site from where transcription start's.
Q: 5. A young woman decided to lose weight and abstained from fat-containing food for several months.…
A: Fats are glycerides (mono, di and tri), sterols, phospholipids and free fatty acids. it is stored in…
Q: 7. After visiting a gym, a student had 250-300 g of carbohydrates for lunch and decided to rest. How…
A: Carbohydrates are the primary source of energy, and glucose molecules are the simplest carbohydrates…
Q: 8. A paticnt sullering from infectious polyarthritis, has been reeciving prednisone for a long time…
A: Prednisone is a kind of glucocorticoid. It is a prodrug, which means the liver converts it to…
Q: Trace the pathway of a protein from translation to the plasma membrane. You may name this protein…
A: Membrane proteins are a part of membrane structure, which are very important for a cell to carry out…
Q: During plasmid extraction, after the addition of acetate-conta in ing neutralization buffer the…
A: Plasmids are extrachromosomal DNA in the bacterial cells. They are double stranded circular DNA,…
Q: In relation to the peptide sequence that is presented. -Gly - Ser – Cys – Asp – Glu – Arg – Cys –…
A: The given peptide sequence contains 8 amino acids. In a peptide, individual amino acids are joined…
Q: SCIENTIFIC PAPER INTRODUCTION ONLY- Titrimetric analysis of amino acids.
A: Amino acids are compounds containing carbon, hydrogen, oxygen, and nitrogen. They are composed of…
Q: Which of the following steps does NOT require ATP? O A. Conversion of glucose to glucose 6-phosphate…
A: Metabolic pathways are a series of process which includes chemical reactions occurring in a cell.…
Q: Why marathon runners eat a meal rich in carbohydrates the day before the race
A: Nutrients are molecules that aids in the growth and development of living organisms. Nutrients are…
Q: 135.) In the citric acid cycle, oxidoreductases are reversible. A) 0 of 4 B) 1 of 4 C) 2 of 4 D) 2…
A: The citric acid cycle oxidizes the acetyl Co-A into the carbon dioxide in the mitochondria. The…
Q: Explain the importance of carbohydrates in your body
A: Carbohydrates are among the most important biomolecules needed for the sustenance of life. They are…
Q: o not copy from anywhere please does a 50% similarity score for two proteins mean that they're the…
A: All living organisms are made up of polypeptides, which contain one or more long chains of amino…
Q: Which of the following is NOT produced during the oxidative phase of the pentose phosphate shunt? a…
A: Pentose phosphate shunt is a metabolic pathway that is involved in the synthesis of pentose sugar…
Q: Which of the following is present in sphingolipids? a). fatty acid b). carbohydrate c). phosphate…
A: Lipid molecules are o amphipathic nature and these molecules are used to make the plasma membrane.…
Q: a. State TWO (2) advantages of Inductively coupled plasma-optical emission spectroscopy (ICP-OES)…
A: Advantages of Inductively coupled plasma-optical emission spectroscopy over flame atomic absorption…
Q: explain Role of telomere in disease give a diagram
A: A telomere is a region at the ends of linear chromosomes that contains repeating nucleotide…
Q: How do you compare and contrast the structures between protein and carbohydrates?
A: Biomolecules are carbon-based organic compounds. Biomolecules are primarily made up of carbon,…
Q: A) For this DNA fragment "TGAATTCCCGGGTTCCGGGAATTCGCGCGAATTCCCGGTATA", what is its complementary…
A: Deoxyribonucleic acid (DNA) is a nucleic acid that carries genetic information from parent to…
Q: HN H3Ñ® Where on this amino acid does it attach to a primary sequence of a protein and where is the…
A: Given amino acid, Histidine is a basic amino acid. The structure of Histidine is presented as a…
Q: 16. Within the chloroplast, grana are ____. Select one: A. stacks of enfolded thylakoid membrane…
A: A chloroplast is a plastid, which is a source of plant cell organelle. Plastids aid in the storage…
Q: Recombinant protein is produced by a genetically engineered strain of Escherichia coli during cell…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: A researcher is trying to identify regulatory DNA sequences near a gene of interes- Several modified…
A: An enhancer is a a short region of DNA that when present either upstream or downstream of a gene can…
Q: True or false Enzymes are not only proteinaceous in nature, but some RNA molecules such as ribozymes…
A: Enzymes are biological catalysts that accelerate chemical reactions.
Q: Genskap/Property A-DNA B-DNA Z-DNA Algehele proporsies/Overall Kort en 1.3.1 Verleng en proportions…
A: The Watson-Crick double-helical model explains the features of the B form of the DNA. There are many…
Q: In the regulation of glycogen phosphorylase, which of the following statements is true? The inactive…
A: Gluycogen phosphorylase is an allosteric Enzyme that catalyses the breakdown of glycogen into…
Q: The eukaryotic metallothionein gene promoter consists of all EXCEPT: a. GRE b. MRE c. GC Box d.…
A: Metallothioneins are proteins that have high affinity towards binding heavy metal ions, and its…
Q: Which of the following CHÍNH, CH HO CHÁNH, CH₂OH I CH H₂N both a and b neither a nor b CHÍNH
A: Stereochemistry is also known as the subdiscipline of the chemistry. Stereochemistry involves the…
Q: 3. Recombinant protein is produced by a genetically engineered strain of Escherichia coli during…
A: Disulfide-bonded proteins primarily mature in the oxidative environment of the eukaryotic…
Q: Modified true or false. If false, replace the underlined word with the correct answer.
A: Glycolysis is a metabolic pathway, through which the glucose molecules are metabolized to synthesize…
Q: Describe the endogenous mechanisms that regulate cholesterol synthesis.
A: Regulation is a process, where enzymes are activated or inhibited to carry out certain process or…
Step by step
Solved in 2 steps
- Describe and explain the 3-D structural change to the protein (uniprotkb-p39086/gene regulator 5) upon initial binding.Explain how the following mutations would affect transcription of the yeast GAL1 gene in the presence of galactose. (a) A deletion within the GAL4 gene that removes the region encoding amino acids 1 to 100. (b) A deletion of the entire GAL3 gene. (c) A mutation within the GAL80 gene that blocks the ability of Gal80 protein to interact with Gal3p. (d) A deletion of one of the four UASG elements upstream from the GAL1 gene. (e) A point mutation in the GAL1 core promoter that alters the sequence of the TATA box.These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
- GTTTTCACTGGCGAGCGTCATCTTCCTACT 8. What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease, etc.) of the protein(s) encoded by the gene.Shown is part of the coding strand of the HBB gene involved in sickle cell disease. What will be the effect on the resulting peptide of a deletion of the two nucleotides shown in bold/underline? 5' CTG ACT CCT GAG GAC 3' a) A change from glutamic acid to valine will occur b) The deletion will not result in a change to the polypeptide c) A nonsense mutation will occur d) The polypeptide will be missing one amino acid, but the reading frame will be preservedThere was a study done (Isabel, et al.) on structural analysis of SARS-CoV-2 spike protein. The researchers hypothesized that a mutation in Asp 614 to Gly 614 will result in a loss of four inter-chain destabilizing (i.e., hydrophobic-hydrophilic) contacts. I attached an image that illustrates this (C). My question is: how does this classify as a repelling effect when Asp 614 should be hydrogen bonding with Thr 859? If Asp 614 is mutated to Gly 614, then wouldn't this hydrogen bonding no longer occur? Just not too sure what this hydrophobic-hydrophilic repelling effect is referring to exactly.
- Which of the proteins: the CAP or the lac repressor, does the eukaryotic nuclear receptor for the glucocorticoid dexamethasone primarily resemble?The codon change (Gly-12 to Val-12) in human rasH that convertsit to oncogenic rasH has been associated with many types ofcancers. For this reason, researchers would like to develop drugs toinhibit oncogenic rasH. Based on your understanding of the Rasprotein, what types of drugs might you develop? In other words,what would be the structure of the drugs, and how would theyinhibit Ras protein? How would you test the efficacy of the drugs?What might be some side effects?A variety of organic chelating ligands have been synthesized to tightly coordinate radioactive metal cations to identify and treat malig- nancies by coupling the metal complex to a polypeptide linker attached to a monoclonal antibody that binds specifically to a cell surface re- ceptor. One such metal complex is illustrated in the diagram on the right. The radioactive Cu-64 cation is tightly coordinated by the che- lating ligand that is, in turn, conjugated to a peptide linker attached to a monoclonal antibody. (The antibody is not shown in this diagram.) When coupled to a specifically designed monoclonal antibody, the complex binds specifically to somatostatin receptors that are ex- pressed on the surface of neuroendocrine tumors. Subsequently the entire complex with the receptor is internalized, i.e., passed into the cytoplasm, where the radioactive metal cation kills the malignant cell. 1. CH3 HN NHNH HN NHNH HN Но НО NH HN S-S HN Но NH NH HN -NH HN- H2N OH NH ) Write the three…
- Propose a mutation for Uniprotkb-P39086 and it’s effectAn important mechanism for generating diversity in immunoglobulin light chain V-region sequences is based on the fact that the RAG recombinase generates hairpin structures, rather than blunt ends, at the cleavage sites between the recombination signal sequences and the coding sequences. Explain how this mechanism generates diversity at the junctions.What is the length in AA’s of the LilP protein? Assume fMet is NOT CLEAVED.