Q: Which of the following is not involved in the process of translation? TRNA snRNA All are involved in…
A: Translation can be defined as the process by which RNA is used to make the proteins. The information…
Q: From the previous question regarding the insertion of an A base into the template strand: will this…
A: The transcription is the process of RNA synthesis from the DNA template. It is the first step of…
Q: If you remove the terminator from a gene, how will this disrupt the function of RNA polymerase?…
A: Transcription is the process of conversion of all the information from the DNA into mRNA in the cell…
Q: Which of the following statements is/are true of stop codons in translation? O Stop codons signal…
A: When the polypeptides are being formed i.e. the process of translation from the mRNA with the help…
Q: Which of the following parts of translation is significantly different in eukaryotes and…
A: mRNA or messenger RNA carries genetic information as nucleotide sequence copied from template DNA…
Q: Which of these are a DNA sequence are which are a protein? Column A Column B 1. A gene's promoter a.…
A: RNA polymerase - Enzyme used to convert DNA into mRNA. Introns - non-coding part of the gene. Exon -…
Q: Which of the following is responsible for the ability of one gene to code for more than one type of…
A: During RNA Splicing: Introns -excised and exons - ligated together.
Q: Which of the following is not a control for translation? Methylation of DNA promotor Increase the…
A: Translation takes place in the cytoplasm (eukaryotes) where the mature mRNA is converted into chain…
Q: A mutation that substitutes a nucleotide sequence, such that in the MRNA transcript the original UAA…
A: mRNA serves as a template for the process of protein synthesis.
Q: A difference between bacterial and eukaryotic translation is Multiple Choice translation can begin…
A: A difference between bacterial and eukaryotic translation is A. translation can begin on an mRNA…
Q: Which of the following is NOT found on a mature eukaryotic mRNA molecule? (Choose all that apply)…
A:
Q: Which of the following are involved in transcription? O RNA polymerase DNA amino acids TRNA acetyl…
A: In translation mRNA, tRNA, rRNA, Amino acids, ribosome, acetyl transferase are required.
Q: Which of the following processes degrades mRNA molecules after transcription if they have a sequence…
A: Introduction :- mRNA ( messenger RNA) is synthesized from dsDNA by the process of transcription with…
Q: The process by which the information contained in mRNA is converted into a polypeptide is called _.…
A: Transcription: DNA converted into mRNA with the help of the RNA polymerase enzyme. mRNA synthesis…
Q: Which of the following processes destroys RNA molecules if they have a sequence complementary to an…
A: Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: As a gene s information is used to create a protein, which of the following is controlled by other…
A: A gene is the basic physical and functional unit if heredity and are made up of DNA.
Q: Which letter in the image represents the end product and the process of translation
A: Answer: CENTRAL DOGMA : It is the process of replication , transcription and translation of DNA.…
Q: Which of the following is true of transcription and translation in prokaryotes and eukaryotes? A. In…
A: Transcription is the process of formation if m RNA from the DNA. Translation is the process of…
Q: Part A Which of the following processes is represented in the figure below? 3' AAG UGA RF1 RF2 O…
A: Thank you for the question Answer :- The given picture shows translation termination Explanation :-…
Q: Which of the following is not possible?a. A nonsynonymous mutation in an intronb. A nonsynonymous…
A: Nonsynonymous mutations are those mutations that can change the protein encoded by mRNA and are…
Q: translation in prokaryotes
A: Translation is the mechanism to synthesis of peptide chain from mRNA sequence. The initiation of…
Q: Which of the following RNAs is the product of transcription? mRNA only rRNA only mRNA, tRNA…
A: Introduction The process of transcribing a piece of DNA into RNA is known as transcription.…
Q: Which of the following is the first step of translation in a eukaryotic cell? a RNA containing…
A: Translation is the process of protein synthesis which is done by ribosomes.
Q: An anti-codon is on what kind of molecule? O DNA O TRNA O polypeptide O MRNA
A: An anticodon is a tri-nucleotide sequence which is complementary to the codon sequence present on…
Q: Which one of the following mutations would cause a shift in the reading frame? O Deletion of one…
A: A mutation occurs when the sequence of DNA changes. Mutations can occur as a result of DNA copying…
Q: Which of the following statements is true of eukaryotic transcription? Exons are spliced out from…
A: Introduction A genome is consisting of transcriptionally active genes. These genes form RNA…
Q: Transcription is a process in which MRNA is synthesized from DNA. MRNA is pro duced from only one…
A: Gene is the sequence of nucleotides that encode a protein. This protein has specific function.
Q: Which of the following step is NOT involved in eukaryotic MRNA synthesis? O Elongation O…
A: DNA is the nucleic acids present in the organisms. DNA is the deoxy-ribose nucleic acid in which…
Q: Which of the following is a function of the 7-methylguanosine cap? a. Exit of mRNA from the nucleus…
A: RNA is the nucleic acids similar to the DNA and contains uracil instead of the thymine. It plays…
Q: result
A: Transition mutation is nothing but the replacement of one purine nucleotide with other and one…
Q: If the codon AAA is mutated to AAG, it still codes for the amino acid, lysine, and the protein…
A: Mutations are the changes in the genes of the cell that causes abnormalities in the structure and…
Q: Which of the following results in the same amino acid in its protein sequence? a. missense mutation…
A:
Q: Below is a segment found in the DNA template strand of a gene for a structural protein. This section…
A: The abrupt changes in DNA sequence of nucleotides is called mutation. It may or may not change the…
Q: Which of the following types of RNA carries the genetic information from DNA in the nucleus to the…
A: Since there are multiple questions in this particular question, I will answer the first one for you.…
Q: Which of the following observations indicates that a genetic code is non-or A base insertion…
A: The genetic code is a set of rules that living cells use to convert information found in genetic…
Q: Energy that drives translation is provided mainly by______ . a. ATP c. GTP b. amino acids d. all of…
A: Translation is the process of protein synthesis using messenger RNA as a template.
Q: Which of the following molecules is (are) produced by translation? N A. RNA polymerase B. The…
A: The translation is a process of synthesis of proteins from the messenger RNA (mRNA). It is achieved…
Q: Which of the following processes includes the removal of introns in the primary RNA transcripts? O…
A: Introns are noncoding sequences of an RNA transcript or the DNA encoding it. In simple terms,…
Q: In RNA, ___________ pairs with adenine. A.Group of answer choices cytosine guanine thymine…
A: RNA (ribonucleic acid) is a nucleic acid which consists of repeating units of ribonucleotides. A…
Q: Which of the following is NOT a protein that aids the ribosome during translation? Question 28…
A: Translation is a process through which polypeptide chains or proteins are synthesized from mRNA with…
Q: The following DNA strand is bound to transcription and translation. Give the translated 5-letter…
A: The nucleic acid polymer has nucleotide as its monomeric unit. synthesis of nucleotide…
Q: A protein was mutated at amino acid position 129. Which of the following mutations will least effect…
A: The correct answer for this question is option- (d) R mutated to D
Q: Which of the following is true about transfer RNA during translation? -Transfer RNA has anticodons…
A: To synthesize protein molecules, a cell must first transfer information from DNA to mRNA through the…
Q: All of the following are true regarding mRNA processing except: O a. It occurs in the cytoplasm of…
A: The central dogma represents the flow of genetic information from DNA to RNA to protein. DNA…
Q: Using the chart below, what type of mutation would take place if the highlighted and underlined "A"…
A: DNA is the carrier of genetic information in almost all organisms except for certain RNA viruses.…
Q: Each one gives some basic information and summarizes its main role in translation. mRNA:…
A: The central dogma was proposed by Francis Crick. There are three major processes: replication,…
Q: 8. Codons are sequences that correspond to specific amino acids or signals during protein…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: Which of the following is the complementary MRNA sequence to a DNA gene with the sequence 3'…
A: DNA is the basic unit of inheritance. DNA contains genes which are transcribed to messenger RNA and…
Q: The following set of RNA is required the translation process except one, mark the INCORRECT? * O a)…
A: Translation is the process by which the synthesis of protein occur. Cells are the basic unit of…
Q: Which of the following would not be found in a mature mRNA in a eukaryotic cell? A Star Codon B…
A: Select the component that is not present in mature mRNA of eukaryotic cells. The given options areA.…
Bacterial Genomics
The study of the morphological, physiological, and evolutionary aspects of the bacterial genome is referred to as bacterial genomics. This subdisciplinary field aids in understanding how genes are assembled into genomes. Further, bacterial or microbial genomics has helped researchers in understanding the pathogenicity of bacteria and other microbes.
Transformation Experiment in Bacteria
In the discovery of genetic material, the experiment conducted by Frederick Griffith on Streptococcus pneumonia proved to be a stepping stone.
Plasmids and Vectors
The DNA molecule that exists in a circular shape and is smaller in size which is capable of its replication is called Plasmids. In other words, it is called extra-chromosomal plasmid DNA. Vectors are the molecule which is capable of carrying genetic material which can be transferred into another cell and further carry out replication and expression. Plasmids can act as vectors.
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT Write the amino acid sequence of the protein that would be formed by translating this plece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids, Use the abbrevlation of the amino adid exactly as Itswritten in the table (including the appropriate capltalizations For example it your answer for amino acid 1 is"Methionine" you would write MET in the box (not Met or met) Second Later UUU UUUC Phe UCU UAU Ser UAC UAA UAG Tyr UGU Cys U Leu UCA ucG UGC Stop uGA Beop UUG Step UGG Trp G Cuu C cuC CUA CUG CU Leu Coc CCA CG CAU Pro cGu CAC CAA CAG His CGC Arg CGA CGG 1st 3rd letter AUU A AUG AUA AUG ACU le AAU AAC AGU ACC Asn Ser U leBer ACC ACA Mct ACG The AAA AAG ACA Lys AGG Arg acu Val GCC GCA GCG GAU GAC GAA GAG GOU GGC GGA GGG Arp G GUC GUA GUG Ala Gly Glu Seovence of the protein, 1st amino acid. 2nd arnino acid: 3rd amino acid: 4th amino acid Sth amino acid: 6th amino acid: 7th amino…Aa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine Threonine
- Oh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…Original DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGCwol for Frayon Elolog - Meet - cha-gX-m sc Jupiter Ed G Which orgerell= A sample of DNA is collected from an organism. It is analyzed and determined that 20% of the DNA is made up of the base adenine. Based on this information, which of the following correctly lists the amounts of the three. remaining bases for this sample? 10% cytosine, 30% thymine, 40% guanine O 20% cytosine, 20% thymine, 20% guanine 30% cytosine, 30% thymine, 20% guanine 30% cytosine, 20% thymine, 30% guanine p. 5 of 31
- EcoRI --- 5' G - AATTC 3' 5' AGAATTCCGACGTATTAGAATTCTTAT CCGCCGCCGGAATTCT CATCA 3' 3' TCTTAAGGCTGCATAATCTTAAGAATAGGCGGCGGCCTTAAGAGTAGT 5' Number of pieces of DNA , and type of fragment .Numbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.Helicase is wrong
- The same DNA sequence as in Questions # 2-4 is rewritten below (Sequence #1). Sequence #2 is the result of a mutation within the original (#1) sequence. Select all of the following words that apply to this mutation: Second letter A First letter U A G UUU UUC UUA UUG U CUU CUC CUA CUG GUU GUC GUA GUG Oinsertion Odeletion Osubstitution Phe Osilent Omissense Ononsense Oframeshift Opoint Leu Leu AUU AUC lle AUA ACA AUG Met ACG C Val UCU UCC UCA UCG CCU CCC CCA CCG ACU ACC GCU GCC GCA GCG Ser Pro Thr Ala CAU CAC CAA CAG AAU AAC AAA AAG UAU Tyr Cys UAC UAA Stop UGA Stop A UAG Stop UGG Trp GAU GAC GAA GAG His Gin Asn Lys Asp G Glu UGU UGCO CGU CGC CGA CGG AGU AGC AGA AGG GGU GGC GGA GGG Arg Ser Arg DOAG DAG DUAG UCAG Third letter Gly Sequence #1: 5'-ATGCACGGCGACTAG-3' Sequence #2: 5'-ATGCTCG GCGACTAG-3'Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…