5. The following is a DNA sequence of gene Z. The underlined sequence representsthe promoter for gene Z and the underlined and italicized sequence encodes thegene Z ribosome binding (RBS) site. Transcription begins at and includes the T/Abase pair at position 60 (bold) - --- 110203040506070-I----5' АTCGGTCТCGGCTACTACАТАAАСGCGCGCATATATCGAТАТСТАGСТАGСТАТCGGTCTAGGCTACTАC3' TAGCCAGAGCCGATGATGTATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGATCCGATGATGI--------I-----I-----I--------I----I---------IPromoter8090100110120130140-I----5' CAGGTATсGGTCTGATCTAССТAGCTTCTтсттстстстстсссссGCGGGGGCTGTACTATСATGCGTCG3' GTCCATAGCCAGACTAGATCGATCGAAGAGAAGAGAGAGAGGGGGCGCCCCCGACATGATAGTACGCAGC-I--I--------I----I---------IRBS150160170180190200210-----I------I--------I----I---------I-----I---------I5' тстCGGCTАСТАCGTAAACGCGCGCATATAтCGATATCTAGCТAGСТАТСGGTстCGGCTACTAсGTAAA3' AGAGCCGATGATGCATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGAGCCGATGATGCATTT220230240250--I--------I--------I----I5' CCCTATTAGCATGGGTCATATTTGTGTCTGCTTGTTGGGT3' GGGATAATCGTACCCAGTAGAAACACAGACGAAGAACCCAa. What are the nucleotides of the MRNA from gene Z?b. What are the amino acids encoded by gene Z? (Vate V

The flow of genetic information from DNA to RNA, RNA to protein synthesis is called central dogma.…

Answered: What are the nucleotides of the mRNA…

Science

Biochemistry

What are the nucleotides of the mRNA from gene Z?

Medical Terminology for Health Professions, Spiral bound Version (MindTap Course List)

8th Edition

ISBN:9781305634350

Author:Ann Ehrlich, Carol L. Schroeder, Laura Ehrlich, Katrina A. Schroeder

Publisher:Ann Ehrlich, Carol L. Schroeder, Laura Ehrlich, Katrina A. Schroeder

Chapter13: The Endocrine System

Section: Chapter Questions

Problem 41LE

See similar textbooks

Related questions

Q: What is polycistronic mRNA ?

A: Polycistronic mRNA is a characteristic feature of prokaryotes but they are also present in…

Q: What are polycistronic mRNAs?

A: Transcription refers to the process of synthesizing the RNA from the template of DNA…

Q: How Is an Amino Acid Matched with Its PropertRNA?

A: The translation is the molecular process by which mRNA was translated into a polypeptide chain or a…

Q: What is the name of the enzyme that adds new nucleotides to build mRNA?

A: Transcription It is defined as the process through which the information in a DNA strand is copied…

Q: In transcription, what is/are the importance of the series of nucleotide bases before the coding…

A: The coding region before transcription flanked by promoter sequence on 5' end on the template strand…

Q: what is it called when an mRNA is edited and where does it happen?

A: Commonly it’s known that mRNA is produced during the process of transcription which will then go for…

Q: How Is the Base Sequence of mRNA Translated into Protein?

A: Translation is a process by which the genetic code contained within a messenger RNA (mRNA) molecule…

Q: What mutations are possible in gene ZFPM2?

A: ZFPM 2 is a multi zinc finger protein. It helps in transcription regulation of certain genes by…

Q: What is the transcribed sequence

A: Sequence that is transcribed from the template DNA using complementary base pairing rules are known…

Q: How do we know that mRNA exists and serves as an intermediate between information encoded in DNA and…

A: It was found that DNA did not directly produce proteins, but instead mRNA transcript is utilized…

Q: what is c-abl mRNA

A: An mRNA is the RNA encoded from a stretch of DNA template strand to serve as a template for the…

Q: What amino acid sequence is coded by the following mRNA base sequence?

A: Genetic code is the sequence of nucleotides in deoxyribonucleic acid (DNA) and ribonucleic acid…

Q: What is the mRNA for a Coding Strand of TAT?

Q: What is the peptide encoded by this mRNA sequence 5’-UCG-GCA- AAU-UUA -GUU-3’?

A: m-RNA consist of 5' to 3' direction as it is synthesized from the dna template in the 5' to 3'…

Q: How do nucleotides of mRNA chains encode information for the formation of the amino acids sequences…

A: The genetic information flows from the form of DNA into the form of protein and this framework is…

Q: What is the protein-coding region? where it is found?

A: Introduction DNA and RNA are the main genetic material found in all the species irrespective of…

Q: Does a gene sequence carry a mutation that might cause adisease?

A: Mutation is defined as any sudden change in the nucleotide sequence of genes. It may also be defined…

Q: How do cells make a mature mRNA from a gene whose coding sequences are interrupted by introns?

A: During the splicing of an RNA molecule, there are two major parts, one is a coding part, known as…

Q: What does the lacA gene code for?

A: DNA is the genetic material in most living organisms. It is the information hub of the cell that…

Q: . What mRNA base sequence would be obtained from the following portion of a gene?

A: Genetic information is transferred from genes to the proteins via messenger RNA.…

Q: How many transcriptional units are there for rRNA and how they are processed?

A: When a cell divides, it creates one copy of its genetic information — in the form of DNA molecules —…

Q: Could two mRNAs have different nucleotide sequences and yet code for the same protein?

A: To synthesize protein molecules, a cell must first transfer information from DNA to mRNA through the…

Q: Explain Mutations in a gene are colinear with the sequence of amino acids in the encoded…

A: A change in DNA sequence is called Mutation. This may be a result of an error in DNA…

Q: How does the transcribed mRNA convert into a functional protein?

A: Introduction: Translation is the process by which ribosomes in the cytoplasm or endoplasmic…

Q: What are the steps in Transcription.

A: Gene expression can be defined as the process in which the information present in the DNA is decoded…

Q: Which are enzymes that shorten the poly-A tail ?

A: Cytoplasmic PABP2 is having some canonical functions. Along with this, it also induces poly(A)…

Q: What role does the poly(A) tail play in mRNA function?

A: Polyadenylation is a process in which poly (A) tail is added to the 3' end of the newly synthesized…

Q: What are the three modifications made to pre-mRNA molecules before they become mature mRNAs that are…

A: The unmodified mRNA which is present in the nucleus is known as a pre-mRNA. In eukaryotic cells, the…

Q: What is antisense RNA? How does it affect the translation of a complementary mRNA?

A: The DNA is replicated via a process called DNA replication. After this process, the DNA enters in…

Q: What are the different terms used to describe the two strands of DNA involved in transcription?

A: Transcription is a process of formation of RNA. It is DNA dependent RNA synthesis process. Process…

Q: The amino acid sequence for a short peptide is Tyr-Leu-Thr-Ala. What are the possible base sequences…

A: Gene expression is the process by which information from a gene is used for synthesizing of a…

Q: What is the mRNA sequence of this DNA and in which direction will mRNA polymerase travel?

A: Messenger RNA is also known as mRNA is a single-stranded RNA molecule, which is complementary to one…

Q: What are the nucleotides of the mRNA from gene Z? (see the attached picture)

A: Transcription is the process of synthesis of mRNA from DNA. The DNA strand which acts as the…

Q: what are Pre-mRNAs?

A: RNA is the ribonucleic acid involved in a biological process like gene expression. There are four…

Q: What are the major differences in the synthesis and structure of prokaryotic and eukaryotic mRNAs?

A: 1) Prokaryotic: are a single celluler organism that has a diameter of 0.1–5 μm, they have a…

Q: How does the translated mRNA convert into a functional protein?

A: Translation is a process in which cells make the proteins.

Q: What are the amino acids encoded by gene Z?

A: Given information The promoter is from the 20-55th position in the sequence. The ribosome binding…

Q: What happens when one base pair of DNA is lost from the coding region of a gene because of mutation?…

A: This type of mutation is known as Deletion mutation in which a single or entire sequence of…

Q: The coding sequences of Gene F and Gene G are shown by the double-stranded DNA below. What is the…

A: The coding sequence of the Gene F and G are given as 5'…

Q: What is the RNA leader sequence?

A: RNA (ribonucleic acid) is a polymer of nucleotides and is composed of a pentose sugar, a nitrogen…

Q: What is a polycistronic mRNA? How are polycistronic mRNAs formed?

A: Answer:Introduction: Polycistronic mRNA means messenger RNA means mRNA containing data for the…

Q: What codon is present near the 3′ 3end of all mRNA molecules?

A: Messenger RNA ( mRNA), this name was proposed by Jacob and Monod. It is always single stranded…

Q: How does the pre-MRNA transcript in the nucleus of a eukaryotic cell compare to the MRNA found in…

A: How does the pre-mRNA transcript in the nucleus of a eukaryotic cell compare to the mRNA found in…

Q: What is the relation of the sequence of the template strand of DNA to the nucleotide sequence of the…

A: The double helix of the DNA gets separated during the process of replication. One strand is known as…

Q: For the ovalbumin gene where would the 5′ untranslated region and 3′ untranslated regions be located…

A: Nuclei acids consist of a sequence of nucleotides, which provides information for protein production…

Q: What is the function of the nucleoid in a bacterial cell?

A: The cell is the basic structural and functional unit of the body in all organisms. Cells are…

Q: How does the poly(A) tail affect mRNA stability?

A: The mRNA molecule refers to the messenger RNA molecule, which plays a role in the synthesis of…

Q: Is there any function for an intron?

A: DNA is the genetic material that carries genetic information in the form of coded nucleotide…

Question

5. The following is a DNA sequence of gene Z. The underlined sequence represents
the promoter for gene Z and the underlined and italicized sequence encodes the
gene Z ribosome binding (RBS) site. Transcription begins at and includes the T/A
base pair at position 60 (bold) - ---

1
10
20
30
40
50
60
70
-I----
5' АTCGGTCТCGGCTACTACАТАAАСGCGCGCATATATCGAТАТСТАGСТАGСТАТCGGTCTAGGCTACTАC
3' TAGCCAGAGCCGATGATGTATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGATCCGATGATG
I--------I---
--I---
--I------
--I---
-I---------I
Promoter
80
90
100
110
120
130
140
-I----
5' CAGGTATсGGTCTGATCTAССТAGCTTCTтсттстстстстсссссGCGGGGGCTGTACTATСATGCGTCG
3' GTCCATAGCCAGACTAGATCGATCGAAGAGAAGAGAGAGAGGGGGCGCCCCCGACATGATAGTACGCAGC
-I-
-I-------
-I---
-I---------I
RBS
150
160
170
180
190
200
210
-----I---
---I--
------I-
---I---------I----
-I---------I
5' тстCGGCTАСТАCGTAAACGCGCGCATATAтCGATATCTAGCТAGСТАТСGGTстCGGCTACTAсGTAAA
3' AGAGCCGATGATGCATTTGCGCGCGTATATAGCTATAGATCGATCGATAGCCAGAGCCGATGATGCATTT
220
230
240
250
--I-----
---I--
------I---
-I
5' CCCTATTAGCATGGGTCATATTTGTGTCTGCTTGTTGGGT
3' GGGATAATCGTACCCAGTAGAAACACAGACGAAGAACCCA
a. What are the nucleotides of the MRNA from gene Z?
b. What are the amino acids encoded by gene Z? (
Vate V

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

Hi, I would like you to answer accurately and in detail this question in the picture, and is it a complete question or is it missing something? Thank you.
_____________________________ are short nucleic acidsegments containing fewer than 50 nucleotides
help me to answer this correctly, thank you ?
10- 00 O SCNSA-SCN10A CDKN1A HANDI VTI1A SYTI • MYOCD 9 10 11 12 13 14 15 16 17 18 19 20 2122 X Y
Design a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?
Please name it ASAP
Please answer, thank you so much!
@-@:$.!
Which one is incorrect?
Please find the attach Question
DNA replication: TAC CAG CCC AAG ATT____________Transcription:Translation:
( Please type answer note write by hend )