Q: What do you call to the selective agent used in the detection of sporeformers from dried ingredients...
A: A "microbe" is a living entity that is so tiny that it cannot be seen with the naked eye. Microbiolo...
Q: What do you think about savior baby therapy? Should saviour babies allowed?
A: INTRODUCTION Saviour baby therapy In this technique we use a form of in vitro fertilization to make ...
Q: the most common method of * indicating pressure in medicine is by the height of a column of mercury ...
A: A manometer is an instrument used to measure and indicate pressure, it is used for measuring the liq...
Q: Referring to Figure 7-20, answer the following questions:a. What is the DNA polymerase I enzyme doin...
A: DNA replication can be described as the process involved in making copies of DNA. This process can b...
Q: Which of the following enzymes are NOT used in recombinant DNA technology O A. Eco RI O B. Ligase O ...
A: INTRODUCTION Recombinant DNA (rDNA) is a process of joining DNA molecules from two different sources...
Q: List and give distinguishing characteristics of members of the Domain Bacteria
A: Bacteria are a diverse group of prokaryotic microorganisms. Bacteria were among the first living for...
Q: What goes wrong with the cardiovascular sytem in hear failure ?
A: Heart Failure: - It is defined as a condition in which the pumping action of heart is unable to meet...
Q: After 4 cycles of PCR, how many copies of DNA would be expected, if the original number of copies wa...
A: PCR which is also called as Polymerase Chain Reaction is a phenomenon in which millions and billion...
Q: In Figure 7-7, do you recognize any of the componentsused to make Watson and Crick’s DNA model? Wher...
A: DNA is made up of nucleotidea. Each nucleotide is made up of a phosphate group, dexy ribose pentose ...
Q: List 2 specific ways that our increased knowledge of DNA has benefited society
A: Introduction :- Nucleotides are the molecules that make up DNA. A phosphate group, which is one phos...
Q: A man runs up a flight of 50 steps in 15 seconds. Calculate mass of man if the power output of his l...
A: Given is that : Total number of steps = 50 Height of each step = 0.2m Power output of leg muscle = 5...
Q: Draw the Hayworth projection for a furanose and pyranose form of D-talose. сно -H -H H- HO- ČH2OH
A: Introduction: Talose is a C-2 epimer of galactose and a C-4 epimer of mannose.It is an aldohexose su...
Q: How do geneticist normally tell whether an organism exhibiting a dominant phenotype is homozygous or...
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous c...
Q: List all the cellular components (organelles and structures) involved in the proteins production. Pr...
A: The study of the formation, functioning, and behavior of cells is known as cell biology. Cells are t...
Q: Provide 3 factors that influence sea level rise. Explain how each factor is influenced over differen...
A: Mostly human-induced global warming is the force behind the current global sea-level rise.
Q: energy transformation steps that occur within an electron transport chain during the process of oxid...
A: all aerobic organisms are require oxygen to live use oxidative phosphorylation to produce the basic ...
Q: the force of blood-- in your arteries when your heart contracts (beats) diastolic pressure None O sy...
A: Cardiac cycle is the term used to describe the relaxation and contraction that occurs as a hard wo...
Q: 60 140 Minimal to no hazards and risks; safety as temperatures increase 55 130 50 120 45 Hazard, but...
A: There are different group of bacteria according to the temperature required for their growth and rep...
Q: Describe the adaptations of terrestrial animals that allow them to be successful on land
A: *Animals can be found every in the earth.They can live on land with diverge conditions. *They can be...
Q: Men have slightly higher values(BMR) than women, because women have less body fat and therefore use ...
A: Basal metabolic rate(BMR) It is the number of calories body needs to accomplish it's most basic or b...
Q: What specific RIM is being described by each of the following statements?Explain your answer in each...
A: Reproductive isolating mechanism Any hereditary trait of body shape, function, or behavior that prec...
Q: A DNA fragment of interest is inserted in the BamHI site of plasmid pBR322.The recombinants will be:...
A: Genetic Recombination: Recombination is a process of alteration of the existing genetic properties o...
Q: Men have slightly higher values(BMR) than women, because women have less body fat and therefore use ...
A: Introduction:- Basal metabolic rate (BMR). BMR is the number of calories your body uses to maintain ...
Q: Fill in blanks with increased decreases or levels off
A: Enzymes are biocatalyst that are proteinaceous in nature and responsible for converting the substed ...
Q: why dna sequence used in the construction of recombinant dna molecules can originate froma ny specie...
A: Recombinant DNA Technology: Recombinant DNA Technology is a method for creating artificial DNA by ...
Q: True False
A: Yes,It is a true statement. Homo naledi fossils were first discovered in Rising Star Cave in South A...
Q: Explain the advanatges and disadvantages of savior baby therapy and what are the three main ethical ...
A: A savior baby or savior sib is a kid who is planned so as to supply an organ or cell transplant to a...
Q: Describe how drinking water is treated. How does a septic system work?
A: Drinking water treatment is done to keep its quality. A septic tank system is a small-scale, undergr...
Q: Which of the following is characteristic of the events at the inhibitory synapse? O Synaptic vesicle...
A: Neurones converse with one another by passing synthetic signs called neurotransmitters across little...
Q: Oldowan stone tools are mostly associated with Homo heidelbergensis Group of answer choices True Fal...
A: Introduction: Evolution is the change in the inherited characteristics of biological populations ove...
Q: 7.The APC protein- ----. a. is essential for degrading B-catenin. b. causes increased activation of ...
A: 7. ANSWER;- A is correct Explain;- The APC protein is essential for degrading β-catenin. The APC p...
Q: Compare bacterial and eukaryotic mRNAs, and explain the functional significance of their structural ...
A: Messenger RNAs (mRNA) are the carriers of genetic information from DNA to proteins. The information ...
Q: Part A: Give an example of when you would want to use a broad-spectrum antibiotic and when you would...
A: INTRODUCTION Antibiotics These are medicines that can inhibit the growth of microorganisms.
Q: A deer eats 25kg of herbaceous material per day. The herbaceous material is approximately 20% dry ma...
A: Food chain it depicts how energy and nutrients flow through an ecosystem. Plants produce energy at t...
Q: What is the purpose of A kinase–associated proteins (AKAPs)? Describe how AKAPs work in heart muscle...
A: The A-kinase associated proteins (AKAPs) are a group of structurally diverse proteins, which have th...
Q: 5. Which among the following statements incorrectly describes a cladogram? Cladogram is the same as ...
A: Evolution is the change in characteristics of species over generations. The theory of evolution stat...
Q: What is the most accepted hypothesis on the origin of life on earth? How does it compare to the othe...
A: Introduction The heterotrophic hypothesis on the origin of life is the most compelling and widely ac...
Q: In complementary base pairing which of the following base parings is incorrect? a. G-C b. G-T OC. A-...
A: ANSWER'- b) G-T Explain;-G-T is incorrect pair. Base pairing happens between a purine and pyrimidin...
Q: How could coacervates have facilitated the emergence of life on earth?
A: Introduction In this question we will discuss about how coacervates have facilitated the emergence o...
Q: Which of the following explains infants' ability to tell the difference between new and old stimuli?...
A: *A newborn baby recognizes his mother voice and pay little attention and baby will see toy this is c...
Q: . E. coli chromosomes in which every nitrogen atom is labeled (that is, every nitrogen atom is the h...
A: Chromosomes can be referred to as structures containing DNA (genetic material). Such structures can ...
Q: The principle of the alkaline method for plasmid DNA isolation is: O A. An acidic solution different...
A: Plasmid DNA isolation by alkaline lysis method This method is the most commonly used method to isola...
Q: 1) In Gram staining, to what cell structure do the dyes bind? 2) Would it be useful to perform a Gr...
A: Gram staining is a method which is used to divide bacterial species into two - gram negative and gra...
Q: Explain how the cell uses glycogen as an energy source. Connect the use of glycogen for energy to th...
A: Glycogen is a large, branched polysaccharide that is the main storage form of glucose in animals and...
Q: f a scientist were trying to separate Klebsiella, Proteus, Shigella, and Vibrio into two separate ca...
A: Let us make a table to analyze their features and then decide which basis of classification will sui...
Q: Evolution______ . a. is change in a line of descent b. is the same as natural selection c. is the go...
A: Different patterns are associated with evolution and such patterns help in categorizing evolution in...
Q: In what type of solution tonicity is this plantcell in? How do you know this? What is it called when...
A: Introduction: Plasmolysis is the process in which cells lose water in a hypertonic solution.
Q: Label the enzyme graph: 3. H F.
A: When we proceed up a reaction in the absence of enzyme it requires a lot of energy and reaction rate...
Q: You are investigating the transport of proteins into the ER in various mutant cells. Where would you...
A: Transport into the endoplasmic reticulum (ER) is the important step inside the biosynthesis of maxim...
Q: explain why we feel headache when we woke up late and not eating a breakfast before going to school.
A: *carbohydrate metabolism is s chemical process that supplies continuous energy to cells. * The major...
Step by step
Solved in 2 steps
- DIRECTION: Express the following DNA nucleotide bases into amino acids. A. 1. 3' ATA TTT CCG TAC CGC GGC GTA GTT TTA ATT 5'Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"Translate the RNA codons using the given genetic code 5' A-U-C-G-A-C-G-A-U-C-C-G-A-U-C-G-A-U 3'
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"B. A polypeptide has 51 amino acids in its primary structure. (i) What is the minimum number of DNA bases required to code for the amino acids in this polypeptide. Show your calculation. (ii) Does AUG appear in the first three nucleotides in the mRNA coding for this mRNA? Explain why.The sequence A is read by RNA polymerase to produce an mRNA that is translated by the ribosome: Choose the sequence that would correspond to that mRNA. A: 3’ – TACGGAACG – 5’ B) 3’ – AUGCCUUGC – 5’ C) 5’ – AUGCCUUGC – 3’ D) 3’ – UACGGAACG – 5’ E) 5’ – UACGGAACG – 3’