Using abbreviations (not structures), write the reaction of flavin adenine dinucleotide that gives off energy (-AG). Match the items in the left column to the appropriate blanks in the equation on the right. H+ FADH → FADH3 + |H* 3/2H2 FADH3 FAD FADH 2H+ FADH2 3H+ H2

Q: Draw a tripeptide only containing Alanine

A: Amino acids are the building blocks of proteins which are composed of amino group (NH3+), carboxyl…

Q: What is the expected molecular weight of the protein encoded by the sequence provided here:

A: A protein is formed by various amino acids linked together by peptide bonds. By knowing the number…

Q: Please answer D and E

A: The sequence of α-endorphin:YGGFMTSEKSQTPLVT corresponds…

Q: Identify the following by describing their functions: EF-G, EF-Tu, EF-Ts, EF-P, and peptidyl…

A: Elongation factors are a set of proteins that function at the ribosome, during  protein synthesis,…

Q: Write the Structure Activity Relationship ( SAR)  of Captopril ?

A: Captopril is an antihypertensive drug and is used for the treatment of renovascular hypertension. It…

Q: What is the difference between a deoxynucleotide triphosphate (dNTP) and a dideoxynucleotide…

A: dNTPs are also called deoxyribonucleotide triphosphate. Each dNTPs are made up of a phosphate group,…

Q: Polyphosphate (poly-P) Exopolysaccharides (EPS) • Autoinducers (AI) • Guanidine tetraphosphate…

A: Answers Rnase is an enzyme that is used to degrade the RNA molecules. While HipAB is a…

Q: Nucleic Acid Chromatogram O O Nucleic acid chromatogram with nucleic acids circled in pencil 00

A: Chromatography is a biochemical technique that is used to separate closely related substances from a…

Q: Draw the following trinucleotide: pGAU

A: A nucleotide is composed of a nitrogen base, a pentose sugar and a phosphate group. A trinucleotide…

Q: Define the term adenosine triphosphate?

A: Introduction   All cells require energy to survive and energy comes from respiration or metabolism.

Q: Lactose permease, a protein of E. coli, is composed of a singlepolypeptide that is 417 amino acids…

A: Translation is the process by which the protein is synthesized by reading the codons in mRNA. The…

Q: Saccharide X, a sugar composed of repeating cellobiose and maltose, is a constituent of a…

A: Plants constitute a large number of carbohydrates. Glycobiology means the study of the…

Q: Given a tripeptide Cys-His-Lys, Cys: Pk1 = 1.71; Pk2 = 10.78; PkR = 8.33 His: Pk1 = 1.82; Pk2 =…

A: pK refers to pH at which a particular group is exactly 50% ionized. A tripeptide is a peptide…

Q: What does the high-energy molecules adenosine triphosphate fforms and reduced forms of nicotinamide…

A: A high-energy molecule is adenosine triphosphate (ATP). It is created by cells and used as a source…

Q: Describe the chemical differences between a ribonucleoside triphosphate and a deoxyribonucleoside…

A: Ribonucleotide triphosphate (RNTPs) and Deoxyribonucleotide monophosphate they are used in…

Q: Which of the following is the polyadenylation signal sequence? AAAAAA O AAUAAA O AAAUAA AAUUAA

A: Polyadenylation signal sequence :- is the signal sequence needed to add poly A tail at 3' end of…

Q: You are studying the toxic protein called ectatomin, a major component of ant venom (specifically…

A: Proteins contain amino acids. They are linked to each other by peptide bonds. The amino acid such as…

Q: Which of the following is NOT a REDOX reaction?   2Al(s) + 3CuSO4(aq) → Al2(SO4)3(aq) + 3Cu(s)…

A: Given,  2Al(s) + 3CuSO4(aq) → Al2(SO4)3(aq) + 3Cu(s)   Cl2(aq) + 2KBr(aq) → Br2(aq)…

Q: Two proteins (A and B) can interact to form a non-covalent complex AB. Suppose the Ka for this…

A: The binding affinity of two molecules at equilibrium is expressed by a numerical constant called the…

Q: The adenine derivative hypoxanthine can base-pair with adenine. Draw the structure of this base…

A: A Wobble base pair is the pairing between two nucleotides in RNA molecules that does not follow…

Q: Lactose permease, a protein of E. coli, is composed of a single polypeptide that is 417 amino acids…

A: Lactose permease Its belong to transmembrane protein family. The transport mechanism of lactose…

Q: MAP= CO x TPR / 80  I don't understand the value of TPR how do I get this number?

A: Mean arterial pressure is the the average blood pressure in an individual during one cardiac cycle.…

Q: Which amino acid pair constitutes the hydrophobic patch on sickle cell hemoglobin that results in…

A: Sickle cell disease is caused due to inversion of one base pair (A -> T). Due to which, the sixth…

Q: Among the following structures, the drug that can be given orally against B-lactamase-producing…

A: β-Lactamase is a type of enzyme that are produced by the β-Lactamase- producing bacteria and play a…

Q: Is the sugar in the nucleotide deoxytibose or ribose? How do you know?

A: DNA/RNA is made up of monomers of nucleotides .

Q: For a protein-DNA binding reaction with ΔH = 0, sketch the van’t Hoff plot, label both axes.

A: Van't hoff equation gives the relationship between equilibrium constant, temperature, and enthalpy…

Q: A biochemist is trying to determine the type of proteases they have isolated from walrus blubber.…

A: Hi! Thank you for the question. We are authorized to answer one question at a time, since you have…

Q: Please provide a chromatography technique to isolate the protein A from the mixture containing…

A: Chromatography is the technique used for the separation of molecules or analytes from the mixture by…

Q: A spheroidal bacterium with a diameter of 1.0 mm (micrometer, 1 mm = 10-6) contains 25,000 molecules…

A: A spheroidal bacterium are circular or oval in shape which are generally known as coccus (plural…

Q: Which of the three 20-amino-acid sequences listed below in the single-letter amino acid code is the…

A: Introduction :- The method of finding the arrangement of amino acids in proteins and peptides is…

Q: What factors account for the high phosphoryl-transfer potential of nucleoside triphosphates?

A: A nucleotide triphosphate is an organic molecule which contains a nitrogen base attached to pentose…

Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…

A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…

Q: Make a table with a scale of absorbance and the concentration of protein in Chromatin sample from…

A: Since you have posted multiple questions, we will provide the solution only to the first question as…

Q: Identify the nitrogen-containing base, sugar and nucleotide name for each of the following item. AMP…

A: Nucleotides are the building blocks of nucleic acids. Nucleic acids are biomolecules responsible for…

Q: To visualize the spatial arrangement of amino acid residues in an a-helix, it is helpful to imagine…

A: Alpha helix is a secondary structure of protein. The alpha-helix can be right-handed or left-handed.…

Q: Assume that the 3 polypeptide strands shown below form a parallel B-sheet. Select amino acids AA1,…

A: Beta sheet is one of type of secondary structure in which inter strand hydrogen bonds is formed…

Q: Identify the structure that is circled in the image below:

A: DNA contains the instructions for protein synthesis. Function of proteins is to determine structure…

Q: Given the Ramachandran Plot below, identify the protein components that could adopt the phi-psi…

A: The bond between nitrogen and alpha carbon (N-Calpha) in amino acid is known as phi bond. On the…

Q: Draw a structural formula for a nucleoside composed of the following. Q.) a-d-Ribose and adenine

A: Nucleosides are glycosylamines that are made up of nitrogenous base (purine or pyrimidines) and…

Q: Given the following pKa data for the individual amino acids, estimate the pI for the tripeptide…

A: In the given data pKa  of amino acids Thr-Asp-Arg is: Thr-? Asp-3.86 Arg-12.48 N-terminal group-…

Q: What is the molecular weight of the Botulinum neurotoxin, a protein that contains 1350 amino acids?…

A: Given Values: Number of residues present in botulinum toxin = 1350

Q: Explain about the four deoxyribonucleoside triphosphates ?

A: Introduction  DNA is the basic genetic material found in most species. DNA stands for Deoxyribose…

Q: Why adenosine tri phosphate is called Biological coin ?

A: Introduction: The cell is considered life's fundamental unit as all tissues, and any organized…

Q: Describe the chemical differences between a ribonucleotide triphosphate and a deoxyribonucleotide…

A: Nucleotide are group which form DNA or RNA .It generally consists of :-  A ) Nitrogenous base  B )…

Metabolic pathways

Metabolism is defined as the group of life-supporting, enzyme-mediated chemical reactions in organisms. A metabolic pathway is a set of these chemical reactions that involve anabolism (synthesis of complex biomolecules) and catabolism (breakdown of biomolecules into small molecules) that occur inside a cell. Metabolites are the reacting substances, products, and intermediate substances of an enzymatic process that are altered by a series of chemical events catalyzed by enzymes.