Seatwork: Give the name of the followingand identify Nucleotide or nucleoside Sugar 2 NH2 но он NH2 онон 1 NH но. но 3 O-P-0-P- -0- он онон
Q: 5. Carbohydrates that cannot be hydrolyzed to compounds with simpler molecules? a. Oligosaccharides ...
A: Hi! Thank you for your questions. As you have asked multiple questions (in total 11-1) but haven't m...
Q: Which of the following TCA cycle intermediates is also a metabolite in gluconeogenesis? O Pyruvate O...
A: Ans). Option 3 oxaloacetate is the correct answer. Explanation: Oxaloacetate which is an intermedia...
Q: 3. What is the molecular formula of sucrose? (in 1 to 3 sentences, explain why this is your answer)....
A: 3. The Molecular formula for sucrose is : a. C12H22O11 Each sugar molecule in sucrose molecule cont...
Q: Give the identity of the monosaccharide components of the tetrasaccharide: А: B: C: D:
A:
Q: Which of the following amino acid groups has the least propensity to be present in a beta turn? O Ly...
A: Almost every function in living organisms depends on proteins. These are the biomolecules composed o...
Q: From the complete oxidation of glucose (glucose → 6CO2), how many total nucleotide triphosphates are...
A: Glucose is metabolized through the glycolytic pathway to yield energy in the form of ATP and NADH. T...
Q: QUESTION 10 There are 2 tyrosines, 6 phenylalanines, and 3 tryptophan in bovine protein. The Molar e...
A: It is given that bovine protein has 2 tyrosine, 6 phenylalanine, and 3 tryptophan residues present i...
Q: o-H H. Hy-H H. From the N-terminus, this sequence is found on the 125th residue onwards. Based on th...
A: Proteins have different structures at its level of complexity. Simple chain of amino acids forms pri...
Q: 7. The only carbohydrate which is not having any chiral carbon atom is (in 1 to 3 sentences, explain...
A: We'll answer the first question since the exact one wasn't specified. Please submit a new question s...
Q: Why might repression of a eukaryotic gene by an RNA be more efficient than repression by a protein r...
A: A gene is a DNA-based functional heredity unit that delivers instructions for the production of RNA ...
Q: Experiment :method of sterilization on glassware and media
A: Sterilization is a process by which all forms of life are killed, deactivated or removed from a part...
Q: Cytosol Mitochondrion A. PATHWAY 1. major pathway of ethanol metabolism NAD* NADH + H* NAD* NADH + H...
A: Ethanol - Small, uncharged molecule Oxidation- Loss of hydrogen; gain of oxygen Reduction- Gain of ...
Q: ndicate what you would do and the observations you would expect for each case. Be explicit in your e...
A: Phenols are family of organic compounds characterized by a hydroxyl group attached to a carbon atom ...
Q: A 50.0 ml juice extract is colorimetrically assayed using Nelson's test. One milliliter (1.00 mL) of...
A: Answer: Principle: Nelson Somogyi method is a version of Somogyi'stitrometric method for use with ...
Q: D. F. G H. Important Values Volume/ml (Caffeine) Intensity 2 Caffeine Buffer (Caffeine] (ASA] 150 pp...
A: Here Stock concentration of Caffeine given is 150PPM To convert this to µg/ml 1µg/ml = 1PPM 150PPM =...
Q: Describe the roles of carbohydrates as antigens in the human body and in RBC
A: Carbohydrate antigens are polysaccharides and glycoconjugates of multiple structural configurations....
Q: Of a 10%6 SDS solution in H20. The combined final solution would be 0.5M NaC1 and 1% SDS. If you are...
A: Molality is never equal to molarity. But the difference becomes lesser as the solutions become more ...
Q: What diseases or conditions if you have buffer deficiency in your body?
A: Diseases or conditions if you have buffer deficiency in the body Answer : There are 2 disorders of a...
Q: Would lactose + lactase be positive or negative for the Iodine test?
A: Lactose is a disaccharide that is commonly found in milk. Lactose is also known as milk sugar. Lacto...
Q: The amino acid that lacks a backbone NH for bond formation to backbone CO group (due to the presence...
A: Amino acids commonly called alpha-amino acids because of a primary amino group(-NH2 ) and a carboxyl...
Q: OH HỌ HO OH но OH но но- но но ÓH This sugar is non-reducing O True O False
A: Sugars are carbohydrates, they are monosaccharides, disaccharides, tri-saccharrides, oligosaccharide...
Q: The equation for the overall reaction that occurs in Complex I is shown below: NADH + H* +Q= NAD+ + ...
A: Gibbs free energy is a measure of enthalpy taking entropy into account. It allows us to relate th...
Q: given a stock solution of 10% dextrose, how would you make 5 mL of a 0.9% dextrose solution? find mL...
A: Given Values: The concentration of the stock solution of dextrose = 10% Concentration of the final s...
Q: Which of the following correctly describes the 3 amino acids that are most likely to undergo phospho...
A: Amino acids are the organic compounds containing amino and carboxylate functional groups along with ...
Q: What organism produced this gene sequence? Provide the full genus and species name. Make sure to spe...
A: Each organism has specific gene sequence associated with it. Given is a specific gene sequence from ...
Q: Which is not a potential side effect of high intakes of omega-3 polyunsaturated fatty acids? A. ...
A: Examples of omega-3 fatty acids, there are α-linolenic acid (ALA), eicosapentaenoic acid (EPA), and ...
Q: When the glycerol-phosphate shuttle is used, the production of this many ATP molecules resulting fro...
A: For completing the aerobic glycolysis, the NADH formed during the conversion of glucose to pyruvate ...
Q: One gram of cultured human cells contains about 10^9 cells and occupies roughly 1 mL. if the average...
A: 1 gram cells = 109 cells 1 cell = 6.4×109 bp per cell 1 bp molecular weight = 660 daltons
Q: Lipoteichoic acid
A: Lipopolysaccharides : lipopolysaccharide (LPS) are the major component found in the outer membrane o...
Q: Biochemistry Question
A: “Since you have posted multiple questions with multiple sub-parts, we will solve the first question ...
Q: Give one physiological c
A: pH is the measure of the strength of H+ ion or Hydronium ions in solution. pOH is the ...
Q: Compound X is a potent competitive inhibitor of enzyme Y. Addition of 10 nM compound X increases the...
A: Enzymes are protein molecules that increase the rate of reaction by decreasing the activation energy...
Q: Chemical properties of fatty acids. Determination of the titer of higher fatty acids in solution. Au...
A: Fatty acids play an important role of fat in our bodies and food. Fats are broken down into fatty ac...
Q: Give the identity of the monosaccharide components of the tetrasaccharide: А: B: C: D:
A:
Q: What are SMC proteins? Describe the function of SMC proteins and explain how they might contribute t...
A: Chromosomes must be supercoiled or they would not fit inside the nucleus (5 micrometers) of human ce...
Q: Given the following information on reduction potentials, calculate the standard free energy in kJ/mo...
A: Gibbs's free energy calculation helps to calculate chemical energy when a bond break or form in a re...
Q: QUESTION 26 If a 10 mg/mL solution of ovalbumin (mol. wt 42 kDa) reacts with Biuret reagent, and has...
A: The biuret reaction :The absorption at 540 nm, being directly proportional to protein concentration,...
Q: Describe the quarternary structure of the enzyme aspartate transcarbamoylase: Dodecamer Monomer Tet...
A: Aspartate Transcarbamoylase (ATCase) : It is allosterically regulated enzyme having quaternary stru...
Q: a) Assuming that ubiquinone is unavailable inside of the cell, calculate the AG and the Keq if elect...
A: Gibbs free energy: Gibbs's free energy is a calculation of chemical energy. All chemical systems fa...
Q: #4: With regard to the Nat-Glucose Symporter (aka Sodium-Glucose Co-transporter), Which of the two s...
A:
Q: Assume that the substrate cycle that exists as shown undergoes reciprocal regulation such that the p...
A: Metabolic flux is defined as the rate of the turnover of molecules in the metabolic pathway by using...
Q: 7. An experimental animal was tested for fatty acids concentration difference on Ist and 30th minute...
A: a) Metabolic pathway of fatty acid: The metabolism of fatty acid involves following steps: 1) Deh...
Q: )Suppose you were culturing a population of bacteria at 37 degrees C and then reduce the temperature...
A: The maintenance of the fluidity of the plasma membrane is important for cell survival. The membrane ...
Q: What is the concentration of enzyme (in mM) needed to achieve a Vmax of 8.00 mM/s if the enzyme has ...
A:
Q: flow chart of purification steps of Beta-fructofruanosidase (Invertase)
A: β-fructofuranosidases are industrially employed due to ease of downstreaming processes(Purification ...
Q: Helping tags: ATP counting, Biology, chemistry, biochemistry, biomolecules, metabolic pathways, cata...
A: Since we only answer up to 3 sub-parts, we'll answer the first 3. Please resubmit the question and s...
Q: What is RT-PCR coupled to Southern hybridization
A: Reverse transcription PCR (RT-PCR) - RNA molecules get converted to complementary DNA (cDNA) molecul...
Q: Draw the products that would be produced from phospholipase C cleavage of a glycerophospholipid with...
A: Fatty acids are important sources of energy and the process of oxidation involves the degradation of...
Q: II. Predict the products of the following reactions, if there is none, write NO RXN. Also indicate, ...
A:
Q: The graph depicts the rate of oxygen consumption of mitochondria in eurythermal killifish (Fundulus ...
A: Q10 is the temperature coefficient. The factor Q10 is the factor by which the rate of a reaction (R...
name and identify
Step by step
Solved in 2 steps
- B. Enumerate all the possible DNA nucleotide base sequence for the amino acids given. 4. Met – Leu – Ala - Gly- Glu - Gly- Gln- Glu- Ala - Ala - Pro - LeuFirst letter U C A UUU UU JUC UUA UUG CUU CUC CUA CUG AUU AUC AUA AUG GUU GUC GUA GUG ] Phenylalanine UCU (Phe) UCC UCA UCG Leucine (Leu) Leucine (Leu) Isoleucine (Ile) Methionine (Met) Valine (Val) CCU CCC CCA CCG b) lysine c) methionine d) tryptophan ACU ACC ACA ACG GCU GCC GCA GCG C Second letter Serine (Ser) Proline (Pro) Threonine (Thr) Alanine (Ala) UAU UAC UAA UAG CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG ] Tyrosine (Tyr) Stop Stop Histidine (His) Glutamine (Gln) Asparagine (Asn) Lysine (Lys) Aspartic acid (Asp) Glutamic acid (Glu) UGU UGC UGA Stop UGG Tryptophan (Trp) CGU CGC CGA CGG AGU AGC AGA AGG GGU GGC GGA GGG ] 1. List the mRNA base codons for the amino acids listed below. 2. a) aspartate: Cysteine (Cys) Serine (Ser) U C Arginine (Arg) A G Arginine (Arg) U C Glycine (Gly) A G U C A G U MCAG АAmino Acid: Asn-Met-Ser-Ile-Phe-Arg-Cys-Tyr-Lys What is the one letter code of this amino acid and what is its classification? What is the side chain description (e.g. amide, aromatic etc.)
- Consider the following two nonhomologous wildtype chromosomes, where letters or numbers represent genes, the "-" represents the centromere of each chromosome, and chromosomes are shown on separate lines. ABCDE-FGHIJK 123-45678 Identify the type of rearrangement shown in each of the following (A-C) and then identify whether it is balanced or unbalanced. Assume that the individual is diploid and heterozygous for the rearrangement. A. • ABCDE-FGHIJKGH 123-45678 Rearrangement: [Select] • Balanced or Unbalanced: [Select] B. • ABCDGF-EHIJK 123-45678 Rearrangement ✓ [Select] • Balanced or Un pericentric inversion Robertsonian translocation deletion tandem duplicate paracentric inversion C. reciprocal translocation ABCDE dispersed duplicate nonreciprocal translocation 123-45Draw the structure of this peptide: N-Met-His-Tyr-Leu-Asp-Ser-Arg-Leu-CSuggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
- why is CH3-CH-CH2-CH2-CH3 non imposable ? I OHIdentify the correct name or abbreviation for the given nucleoside or nucleotide. guanosine ADP dADP dGDP GDP Identify the correct name or abbreviation for the given nucleoside or nucleotide. GDP dADP ADP O deoxyadenosine dGDP OMP O || -O-P-O-P-O. fot O™ tt -O-P-O- O™ ܘ ܐ ܘ ܐ OIPIO N OH OH OH N H₂N N ΝΗ N NH₂Translate the following DNA sequence into amino acids 5'ATAGTACCGCAAATTTATCGCT3 O met-ala-phe-lys-stop O met-ala-phe-lys- met-tyr-his-gly-val-stop-met-gly O met-ala-ser-gly-thr-stop O tyr-his gly-val-stop-met-ly O ala-phe-lys stop
- Drew the peptide sequence and write its full name Cys-Gln-Lys-His-Ala-Ser-GlnIdentify the sequence'of the peptide below. C-N-CH-COOH C-N-CH- H H CH- H,N*-CH-Ċ-N-CH-Ċ-N-CH-Ö-N-CH-Ċ- H CH, CH2 ČOOH H CH, H CH, H CH, CH, CH, CH2 *NH, H CH, он CH, SH S CH, O CAEKGSM O MSGKEAC O CAKEGMS O KEACMSGa. Use three-letter amino acid abbreviations to write the representation for the tripeptide shown here. i H₂N-CH-C-N-CH-C-N-CH-C-0- CH₂ H -NH H ī CH₂ SH -CH-C-0- CH-OH CH3 b. Give the full name of the amino acid at the C-terminal end of this tripeptide. H₂N-CH-C-N-CH-C-N-CH-C-O- -CH-C-N-CH-C CH₂ c-o- CH₂ OH