Please explain the following terms: Chirality Enantiomer Stereoisomer Diastereomer
Q: Br H3C Br CH3 H. CH3 CH3 CH3 H3C Br "Br Br Br
A: Stereoismers have identical molecular formula and arrangement of atoms.
Q: Draw the Haworth structure of the tetrasaccharide:
A:
Q: Sugars that differ in one chiral center of many are called_____________________.
A: Carbohydrates consist of carbon, hydrogen, and oxygen and the empirical formula of carbohydrates are…
Q: Indicate which base is (or bases are) the complementarypaired base(s) for each of the…
A: Answer: Introduction: DNA - Deoxyribonucleic acid is a molecule that is used for storage of genetic…
Q: Define hydroxyl groups.
A: The “functional groups” are explicit groupings of atoms in a molecule that have their own trademark…
Q: Draw the structure and name the following polypeptides:
A: Given sequence: 1. SRAL 2. ENIRYTAK Lets see which amino acid is denoted by each letter: S = Serine…
Q: Study the given structures below. Which of the following are enantiomers?" -OH но- H- HO- но- HO-…
A: Enantiomers are molecules that are exact mirror images of each other. They cannot be superimposed on…
Q: Identify the monosaccharides and their linkages in the following disaccharide. HOCH, Но H. -0-CH2 OH…
A: To identify the monosaccharides and their linkage in the given disaccharide.
Q: Write definition of α- and β-anomers of monosaccharides.
A: Monosaccharides are monomers that form the polymer polysaccharides (carbohydrates). A monosaccharide…
Q: Give one specific sample structure (Fischer Projection or Haworth) of the following carbohydrate…
A: Alditols are produced by reducing the aldehyde or a ketone group of monosaccharides or glycans at…
Q: Complete the following table by providing the Fischer and Haworth Projections of the given sugars.…
A: Fischer projection is a three-dimensional representation of sugar molecules in an open-chain form.…
Q: How many different Aldoses are possible of a 10-Carbon molecule? Consider the possibility of…
A: General formula of 10 carbon monosaccharide is C10H20O10 and exist either in aldose or ketose form.
Q: Identify enantiomers form the following organic structures ÇH: ÇH: ÇH3 ÇH: ÇH: H- -CI H- -CI CI- -H…
A: Biochemistry is defined as the branch of science that deals with the study of chemical substances…
Q: _____________ are nonsuperimposable, non-mirror-image stereoisomers.
A: Stereoisomerism is considered as the spatial arrangement of the atoms which differs in isomers.
Q: Which of the following is the correct systematic name of the disaccharide shown? OH OH но но но- он…
A: Carbohydrates are composed of carbon, hydrogen, and oxygen in the ratio of 1:2:1. Carbohydrates act…
Q: In the L-isomer of a Fischer projection of a monosaccharide, the defining - OH group is written on…
A: Fischer Projection was formulated by Emil Fischer (1891) and it use to draw 3D-diagram of chiral…
Q: Amino acid +Amino acid >Dipeptide +______
A: Proteins are macromolecules composed of monomeric units called amino acids. These amino acids are…
Q: The amide linkages of proteins are referred to as________________________.
A: Introduction: Proteins are major biomolecules that consist of long chains of amino acids. The…
Q: Define monosaccharide
A: Introduction: A carbohydrate is a molecule made up of carbon (C), hydrogen (H), and oxygen (O) atoms…
Q: Define polysaccharide
A: Introduction: A carbohydrate is a molecule made up of carbon (C), hydrogen (H), and oxygen (O) atoms…
Q: Which stereoisomer of the monosaccharide threose is shown below? a. D b. L c. R d. S
A:
Q: Choose from the following pairs. Which are constitutional isomers? Pair A Br
A: constitutional isomers are structural isomers that they differ in structure but have the same…
Q: Draw the following fictional groups. Hydroxyl Carbonyl Carboxyl Amine
A: Hydroxyl, methyl, carbonyl, carboxyl, amino, phosphate, and sulfhydryl groups are some of the most…
Q: How many different stereoisomer forms exist for a biologically-derived aldose with 6 carbons? a) 2…
A: Stereoisomers are molecules that consist of the same molecular formula but are arranged in different…
Q: Which of the following are known as helix breakers? O Proline Isoleucine leucine O Valine O…
A: Helix breakers are the amino acids that are capable of disrupting the alpha helical back bone and…
Q: State the structural similarities and differences of cellulose and amylose.
A: Polysaccharides are also known as polycarbonates. They are the most common form of carbohydrates.…
Q: Identify the monomers for the following polymers A.) Maltose B.) Sucrose C.) Lactose
A: INTRODUCTION Monomers are building blocks of polymers. The above mentioned compounds are…
Q: All of the following are monosaccharaides except.(check all possible answers) * sorbose galactose…
A: Monosaccharides are the smallest carbohydrate molecules. They cannot be broken down by hydrolysis.…
Q: IUPAC name for the structure given. (DO NOT write "cis or trans") * ннннн ннн ннннн…
A: Systematic names given to a chemical structure is known as the IUPAC name. IUPAC stands for…
Q: Which statement is true concerning the nucleotide shown below? The base is a purine and the sugar…
A: The nucleic acids are polymers of nucleotides. Nucleotides can be considered the building blocks of…
Q: What is the Fischer projection of the nonulose structure above? H OH H OH HOH HOH H OH HOH H OH HOH…
A: The fischer projection of given nonulose structure is.. fischer projection is 2-D image of 3-D…
Q: dentify the following types of biomolecules and label and identify all of the functional groups
A: A structural segment of nucleic acid that possesses a sugar molecule like ribose sugar attached to a…
Q: Following are Fischer projections for a group of five-carbon sugars, all of which are dopentoses.…
A: Enantiomers are optical isomers that are non-superimposable mirror images of each other that differ…
Q: Complete the following table by providing the Fischer and Haworth Projections of the given sugars.…
A: Carbohydrates are polyhydroxy aldehyde and ketone that are composed of carbon, hydrogen, and oxygen…
Q: Classify the following carbohydrates as : A. Monosaccharide B. Disaccharide C. Oligosaccharide D.…
A: Pentose is a five-carbon simple carbohydrate (monosaccharide). An example of a pentose sugar would…
Q: Cellulose is a large polysaccharide contai
A: Cellulose : cellulose is a polysaccharide of glucose units , consists of carbon hydrogen and oxygen…
Q: A nucleoside consists of an organic base, bound to ribose or deoxyribose. Draw the structure for…
A: Nucleotides are the monomers of nucleic acids, DNA and RNA. A nucleotide is composed of a…
Q: Identify if the following is a pyrimidine/purine nucleotide or a pyrimidine/purine nucleoside and…
A: Answers Image A - The given image is a Purine Nucleoside. It has deoxy ribose sugar molecule in it.…
Q: Indicate whether each of the following stereoisomers is true or false. a. Stereoisomers always have…
A: Stereoisomers are the isomeric forms that differ in spatial arrangement of atoms, rather than order…
Q: Study the given structures below. Which of the following are enantiomers? * H- OH но- - H OH но- -H…
A: Carbohydrates or carbs are maconutrient consisting of Carbon, hydrogen and oxygen atoms. In nature…
Q: Complete the following table by providing the Fischer and Haworth Projections of the given sugars.…
A: Hello. Since your question has multiple sub-parts, we will solve the first three sub-parts for you.…
Q: How many stereoisomers are possible for the following monosaccharide? a. 4 b. 8 c. 16 d. 2 e. 1
A: A monosaccharide is the primary essential kind of carbohydrate. By glycosidic bonds, monosaccharides…
Q: How many stereoisomers are possible for D-xylulose? A) 10 B) 6 C) 8 D) 4
A: Introduction: D-xylulose is a ketopentose having five carbon atoms in its structure. Option D) is…
Q: HO-C-H H-C-OH HO-C-H H-C-OH ČH2OH
A: The Fischer projection was proposed by Emil Fischer in 1891. It depicts a three-dimensional molecule…
Q: Choose one example of a carbohydrates with a chiral carbon and draw its Fisher's and Haworth's…
A: Carbohydrates are classified as monosaccharides, oligosaccharides, and polysaccharides based on the…
Q: Two sugars which differ from one another only in configuration around a single carbon atom are…
A: Diastereomers, enantiomers, epimers etc are terms used to study stereochemistry of biomolecules.…
Q: НО IZ NH₂ HO
A: The given molecule is composed of carbon, hydrogen, oxygen, and nitrogen. Molecules composed of…
Q: Which of the following monosaccharides structural relationship is CORRECT? * сно сно сно но- -H H-…
A: The stereoisomers have the same composition but differ in the orientation of parts in space. Two…
Q: NH2 Н-С-СООН | H Glycine Glycine is what type of monomer Name the 4 things attached to the center…
A: Proteins are made up of amino acids. The amino acids form amide bonds (CO-NH) between the carboxyl…
Q: Identify the chiral carbon in each of the following compounds: a. citronellol; one enantiomer has…
A: Organic compounds are often composed of carbon, hydrogen, oxygen, and nitrogen. The structural…
Please explain the following terms:
Chirality
Enantiomer
Stereoisomer
Diastereomer
Step by step
Solved in 2 steps
- Describe the tertiary (3º) structure of proteins and the different types of intermolecular forcesinvolved. Provide a structural example for each force.What is meant by the term "Critical concentration" with respect to actin filaments?Drag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson arch
- Discuss (as comprehensively but as concisely as possible) the role of protein folding in any (one) of the following diseases. Suggest an accepted appropriate treatment for the disease. Cite your references. (a) Alzheimer’s disease (b) Parkinson’s disease (c) Cystic fibrosis (d) Gaucher’s diseaseThe melanocyte-stimulating hormone a-melanotropin has the following sequence: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val In the one-letter code of amino acids, this sequence would be: SYSMEHFRWGKPV STSMGHFAWGKPV O SYSMDHFAWGKPV O SYSMEHFAWGLPVExplain the reason for which the concentration of actin to be 50-100 times greater than the critical concentration.
- Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSAConsider the following two nonhomologous wildtype chromosomes, where letters or numbers represent genes, the "-" represents the centromere of each chromosome, and chromosomes are shown on separate lines. ABCDE-FGHIJK 123-45678 Identify the type of rearrangement shown in each of the following (A-C) and then identify whether it is balanced or unbalanced. Assume that the individual is diploid and heterozygous for the rearrangement. A. • ABCDE-FGHIJKGH 123-45678 Rearrangement: [Select] • Balanced or Unbalanced: [Select] B. • ABCDGF-EHIJK 123-45678 Rearrangement ✓ [Select] • Balanced or Un pericentric inversion Robertsonian translocation deletion tandem duplicate paracentric inversion C. reciprocal translocation ABCDE dispersed duplicate nonreciprocal translocation 123-45Regarding actin filaments, colchicine and taxol effects actin polymerization/depolymerization, what are the names of drugs that have a similar action on microtubules? colchicine = taxol=