Participation Problem: Chapter 10, Problem 4: The lipid portion of a typical bilayer is about 30 Å thick. (a) Calculate the minimum number of residues in an a-helix required to span this distance. (b) Calculate the minimum number of residues in a ß-strand required to span this distance. Skip part (c) (d) The epidermal growth factor receptor (EGFR) has a single transmembrane helix. Find it in this partial sequence. ...RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH... Table for reference (for parts a-b):

Participation Problem: Chapter 10, Problem 4: The lipid portion of a typical bilayer is about 30 Å thick. (a) Calculate the minimum number of residues in an a-helix required to span this distance. (b) Calculate the minimum number of residues in a ß-strand required to span this distance. Skip part (c) (d) The epidermal growth factor receptor (EGFR) has a single transmembrane helix. Find it in this partial sequence. ...RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH... Table for reference (for parts a-b):

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter4: Cell Structure

Section: Chapter Questions

Problem 23RQ: The key components of desmosomes are cadherins and. actin microfilaments intermediate filaments...

See similar textbooks

Similar questions

Multipass transmembrane proteins synthesized by ribosomes on the rough endoplasmic reticulum generally have which of the following arrangements of start-transfer and stop-transfer signals? multiple start signals and multiple stop signals (to allow multiple transmembrane regions) multiple start signals, but only one stop signal (to allow only one transmembrane region) only one start signal, but multiple stop signals (to allow only one transmembrane region) only one start signal, and only one stop signal (to allow only one transmembrane region) only one stop signal, and only one start signal (to allow only one transmembrane region)
Membrane Protein Insertion in the ER This figure displays five small hypothetical proteins. The a-helix secondary structure of the protein is bracketed and the number of amino acids in the helix is indicated. If the hypothetical ER localization sequence is green-yellow-yellow-green-yellow-red, what protein could potentially be a transmembrane protein in the plasma membrane? = Acidic = Basic = Polar (uncharged) O = Hydrophobic CO₂ T 20 CO2 T 20 NH₂ A. T 20 NH₂ B. NH₂ C. T 20 NH₂ D. NH₂ E. tot 10
The lipid portion of a typical bilayer is about 30 Å thick.(a) Calculate the minimum number of residues in an a-helix required tospan this distance.(b) Calculate the minimum number of residues in a b-strand required tospan this distance.(c) Explain why a-helices are most commonly observed in transmembraneprotein sequences when the distance from one side of a membrane to theother can be spanned by significantly fewer amino acids in a b-strandconformation.(d) The epidermal growth factor receptor has a single transmembrane helix.Find it in this partial sequence: . . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . . .
Dynamic instability causes microtubules either to grow or to shrink rapidly. Consider an individual microtubule that is in its shrinking phase. What would need to happen at the end of the microtubule in order for it to stop shrinking and to start growing again? Be specific! What would happen if only GDP, but no GTP, were present in the solution? What would happen if the solution contained an analog of GTP that cannot be hydrolyzed?
I am studying pancreatic islet cells and have isolated, cloned, and sequenced a novel protein that you postulate has 4 transmembrane segments. Name and explain two methods I could use to reconstitute a lipid bilayer to study the function of the transmembrane protein in vitro.
CELL STRUCTURE AND FUNCTION – EUKARYOTES, PROKARYOTES AND VIRUSES-LABORATORY REPORT SHEET ACTIVITY 2: CELL MEMBRANES, OSMOSIS AND DIFFUSION Initial Volume (Vi) (mL) Final Volume (Vf) (mL) Change in Volume (Vi – Vf) (mL) A 20% sucrose 20% sucrose 92.0 mL 94.0 mL -2.0 mL B 40% sucrose 20% sucrose 92.0 mL 92.0 mL 0.0 mL C 20% sucrose 40% sucrose 92.0 mL 90.0 mL 2.0 mL Treatment Percent Change A -2% B 0% C 2% Hypothesize which dialysis bags should gain, lose or stay the same in regards to volume. Explain. Which solution is hypotonic, hypertonic and isotonic? Explain what the change in volume of the dialysis tube indicated and describe what happened when the volume increased and when the volume decreased. Explain the relationship between solute concentration and amount of free water or water available for movement.
multiple choice question : The structure of silk fibroin is dominated by (a) B-form duplex with occasional flipping into left-handed Z-form (b) antiparral strands in stacked beta pleated sheets (c) hydrophobic residues form a surface shell with hydrophillic residues in the molten core (d) self-complementary stems terminated by loops (e) random coils and domains anchored to the nuclear scaffold
Bacteriorhodopsin is an integral membrane protein containing 248 amino acids. X- ray analysis of this protein reveals that it consists of seven parallel a-helical segments, each of which traverses the bacterial cell membrane. Calculate the minimum number of amino acid residues necessary for a single a-helical segment to completely traverse the bacterial cell membrane (assume the membrane has a thickness of 4.1 nm). (a) (b) Estimate the fraction of the bacteriorhodopsin protein that is involved in membrane-spanning helices.
The lipid portion of a typical bilayer is about 30 Å thick. (a) Calculate the minimum number of residues in an α-helix required tospan this distance. (b) Calculate the minimum number of residues in a β-strand required to span this distance. (c) Explain why α-helices are most commonly observed in transmembrane protein sequences when the distance from one side of a membrane to the other can be spanned by significantly fewer amino acids in aβ-strand conformation. (d) The epidermal growth factor receptor has a single transmembrane helix. Find it in this partial sequence: . . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . .
Cleavage Ligand Precursor Receptor Inactive Receptor Active Cell Membrane 6. The figure above shows a model of a ligand precursor being cleaved to produce an active ligand that binds to a specific receptor. Which of the following is most likely to reduce the binding of the active ligand to its receptor? (A) A change in the cytoskeletal attachment of transmembrane proteins (B) The presence of a large amount of the precursor form of the ligand (C) An increase in the ratio of the number of unsaturated to the number of saturated fatty acid tails of the membrane lipids (D) A mutation in the receptor gene that causes a substitution of a charged amino acid for a nonpolar amino acid in the ligand binding site of the receptor
Name the three major assumptions made by the "Cell theory". (i) The lipid membrane is composed of lipid molecules. Explain the principle of membrane formation highlighting the role of the physical properties of the lipids. (ii) Comparing dimensions and length scales is often a first step in an analysis. Give an approximate value for the thickness of a lipid bilayer and the linear length of a helical turn of a DNA double helix. A technician wants to amplify DNA from a patient sample. However, the lab is not equipped with a thermocycler. (i) (ii) Name two methods for DNA amplification that can be operated at constant temperature and give their acronyms. Explain these two methods in detail using a schematic and name all necessary components that are required to perform the amplification. Describe the main function of the middle ear. Highlight the role of the ossicles and the tympanic membrane.
molecules of actin could it hold? Assume the cell is spherical The Size of Cells and Their Components (a) If you were to magnify a cell 10,000-fold (typica] of u magnification achieved using an electron microscope), ho ples of Bioch 1. yotic cell with a cellular diameter of 50 µm. (b) If this cell were a muscle cell (myocyte), how many and no other cellular components are present; actin molecules are spherical, with a diameter of 3.6 nm. (The volume of a sphere is %ar.) (c) If this were a liver cell (hepatocyte) of the same dimensions, how many mitochondria could it hold? Assume the cell is spherical; no other cellular components are pre- sent; and the mitochondria are spherical, with a diameter of 1.5 µm. h (d) Glucose is the major energy-yielding nutrient for most cells. Assuming a cellular concentration of 1 mM (that is, 1 millimole/L), calculate how many molecules of glucose would be present in our hypothetical (and spherical) eukaryotic cell. (Avogadro's number, the number of…