Lane M 1 2 3 4 5 Content DNA ladder Replicate 1 Replicate 2 Replicate 3 Negative control Positive control 700 bp 600 bp M 1 2 3 4 5
Q: Complete the following chart about PDHK activity by determining if the molecule would be in high or…
A: Pyruvate dehydrogenase kinase stands for (PDHK). This PDHK belongs to the kinase enzyme family.PDHK…
Q: Compare and contrast some of the artificial sweeteners:aspartame,saccharin, sucralose, erythrol
A: Artificial sweeteners are used for sugar replacements. This sweetener provides a sweet taste to…
Q: what is the Cartagena protocol and how do the articles of the Cartagena protocol regulate the…
A: Cartagena protocol is an international agreement on Biosafety and as a supplement to convention on…
Q: The following enzymes are involved in carbohydrate digestion in the microvilli, except?
A: Carbohydrate digestion starts with the mouth itself. The salivary glands present in the mouth…
Q: gene therapy in humans and other animals, the types of gene therapy, the methods used, and the…
A: Gene therapy is a medical approach to treat disease including cancer , genetic , or infectious…
Q: Explain what hydrogels are as a group of material. Discuss and illustrate with examples the most…
A: Large molecules which are synthetically made or obtained naturally and are made up of many simpler…
Q: How does the degree of unsaturation and structure of fats affects its functionality, for example in…
A: Lipids are not polymers. The simplest form of lipid is fatty acids which are a long chain of…
Q: What are the different applications of Gel Electrophoresis?
A: The variation in size and charge of distinct molecules in a sample is exploited by the gel…
Q: Which of the following is incorrect concerning protein structure determination by X-ray…
A: Protein structure determination by X-Ray Crystallography: is a technique used to obtain the 3D…
Q: Which of the following is not a general description of the gene expression regulation mechanisms…
A: Gene expression regulation mechanisms helps to maintain the rate of gene expression or to regulate…
Q: To establish a standard curve for a BSA standard curve using Bradford, the spectrophotometer…
A: Proteins are composed of twenty standard amino acids attached together via peptide bonds. These…
Q: A researcher is trying to identify regulatory DNA sequences near a gene of interes- Several modified…
A: An enhancer is a a short region of DNA that when present either upstream or downstream of a gene can…
Q: Match the following methods of Anlaysis v Fractional analysis, methylation, and periodate oxidation…
A: Different chemical, physical and enzymatic methods in several applications of biological, chemical…
Q: 1. Label the "C" monosaccharide 2. Draw the open chain Fischer projection formula of the…
A: In the given molecule the different sugars are attached with the help of glycosidic bonds.
Q: List possible glucogenic products of amino acid degradation
A: Aminoacids are classified into two types based on their fate of conversion to glucose or ketone…
Q: An inhibitor "I" is added to the enzymatic reaction at a concentration of 1.0 g/L. The data obtained…
A: The reciprocal kinetic data is as follows: 1/[S] L/g 1/V (min-L/g) E = 0.015 g/L (Without…
Q: Which is true about eukaryotic cDNA? Choose all that apply. a. it is constructed from mRNA that…
A: Complementary DNA (cDNA) is made from messenger RNA in the laboratory for various purposes. Because…
Q: 87) For a the viral proteins a. If the viral protein is made in the RER, it will go back to the…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: A 44-year-old man diagnosed with acute tubular necrosis has a blood urea nitrogen of 60 mg/dL and a…
A: A heart attack or a heart stroke can cause the tubular necrosis. This is a condition in which the…
Q: the first two reactions in glycolysis associated with unfavorable ∆G° values, i.e., ∆G° > 0, both…
A: Glucose molecules are metabolized through the glycolytic pathway to release energy in the form of…
Q: 10 b. How many different proteins composed of 100 amino acids could possibly exist?
A: The building blocks for the synthesis of proteins are amino acids. 20 different amino acids…
Q: Benefits of a project "Drinking Water Refilling Station " to individuals and families and community…
A: Refilling stations for water bottles are now one of the most popular methods of decrease the…
Q: Please describe the protein purification process with the aim of purifying a protein which locates…
A: We will answer the first question since the exact one was not specified. Please submit a new…
Q: Which isomer- (R)-arginine or (S)-arginine is D-arginine? O (R)-arginine O (S)-arginine Submit…
A: Isomers are molecules with same molecular formula and different arrangement of atoms. Enantiomers…
Q: In the Krebs Cycle (Citric Acid Cycle), A 4-carbon compound with a 2-carbon unit to yield a 6-carbon…
A: Kreb cycle/ tricarboxylic acid cycle/ citric acid cylce - occur in matrix of mitochondria.
Q: state why simplicity and speed are top priorities in selecting DNA isolation method
A: DNA isolation is the first basic step that is carried out in biological science to study on that…
Q: How does salt help in the DNA extraction process?
A: DNA is extracted to compare the DNAs from different sources and to study the sequence differences.…
Q: (b) Provide the mechanism of Merrifield Resin synthesis taking any tripeptide. Explain one method of…
A: The Merrifield Resin is a cross-linked polystyrene resin that carries a chloromethyl functional…
Q: What is the role of the substrate? Is it really necessary to add substrate in ELISA?Explain why, or…
A: The antibodies that can specifically bind to an antigen can be used for the detection of the…
Q: Give the name of the enzyme that we have studied this semester that catalyzes the most similar…
A: Coenzyme A (Co A) → -SH group present in coenzyme A is a thiol, it can react with -COOH to form…
Q: complete the sentence with a preposition ( in , at, on) or (no preposition) I phone you. five…
A: Note : Hi ! Thank you for the question. We are authorized to answer three subparts at a time. Since…
Q: The following bond makes bovine pancreatic trypsin inhibitor as one of the stable proteins.…
A: Introduction: Bovine pancreatic trypsin inhibitor (BPTI) binds to trypsin and prevents peptide…
Q: Complete the table by simply identifying only one example in each type of carbohydrate.
A: Monosaccharides - it is a basic unit of polysaccharides or carbohydrates, which cannot be broken…
Q: Problem 2. Competitive inhibitors are commonly used to make pharmaceuticals. Some cancer drugs act…
A: We need to plot the Lineweaver Burk Plot (LB Plot) to solve this problem. So first we need to find…
Q: . This cell is dependent solely on glucose as an energy source a.Muscle cells b.Kidney cells…
A: 1. the cell that solely dependent on glucose source is- Answer- d. brain cells Glucose in human…
Q: How is it possible to maximize ethanol production using genetically modified yeasts?
A: A novel genetic engineering technique was used to make yeast more resistant to the negative effects…
Q: 6. Gluconeogenesis generates ________. Select one: A. 2 ATP and 2 NADH B. 1 ATP and 1 NADH C. 1…
A: Gluconeogenesis is a metabolic pathway that results in the generation of glucose from certain…
Q: How does the mouth achieve initial digestion of carbohydrates? Read and analyze the question and…
A: Carbohydrate digestion begins in the mouth with the mechanical action of chewing followed by the…
Q: The following plasmid is digested with EcoR1 and Ndel restriction endonucleases. Agarose…
A: Restriction endonucleases are enzymes which cleave the phosphodiester bonds within a DNA. These…
Q: Describe the common strategy (steps) for protein sequencing, starting with a biological sample…
A: Proteins are one of the 4 major biomacromolecules. Proteins are the most abundant of the 4…
Q: Which of the following is not a net product (i.e. of both phases) of the pentose phosphate shunt?…
A: Pentose phosphate pathway involves two phases , oxidative and non oxidative . It is a primary…
Q: Draw the complementary DNA strand for the given: 5'-A-T-C-C-G-A-A-T-T-G-3' Draw the complementary…
A: Let us first understand the one letter codes for the given nucleotides: A is Adenine T is Thymine…
Q: o not copy from anywhere please does a 50% similarity score for two proteins mean that they're the…
A: All living organisms are made up of polypeptides, which contain one or more long chains of amino…
Q: Which of the following is NOT one of the products of the pentose phosphate shunt?
A: The pentose phosphate pathway is the one important metabolic pathways which is take place in most of…
Q: 1. A 185g plant based burger is composed 55% carbohydrates, 35% protein and 20% fat. Calculate the…
A: Total energy of a food is expressed in calories. A calorie is a unit of how much energy is in a…
Q: Name the functional group present in fructose molecule and kink to water solubility of this sugar.…
A: Sugars come in a variety of forms, some of which are more popular than others. Fructose, like…
Q: B-oxidation of a molecule of palmitate (i) requires water (ii) requires NADH (iii) produces NADPH
A: "Since you have asked multiple question, we will solve the first question for you. If you want any…
Q: 3. Recombinant protein is produced by a genetically engineered strain of Escherichia coli during…
A: Disulfide-bonded proteins primarily mature in the oxidative environment of the eukaryotic…
Q: Sugar is an organic molecule. Most organic molecules are non-polar compounds making them insoluble…
A: A polar molecule is a molecule containing polar bonds having non-zero dipole moments.
Q: for GABA transaminase, ornithine decarboxylase, and alanine
A: PLP-dependent enzymes catalyse a wide range of reactions that result in bond cleavage at the carbons…
- Ben used the following primer pairs to amplify the COI region of his DNA template:
Afterwards, he used Agarose Gel Electrophoresis to visualize the PCR products.
Based on the gel:
a) Was he able to successfully amplify the desired region in all replicates?
b) Are there errors in Ben's gel? Does he need to repeat his PCR?
Step by step
Solved in 4 steps
- Aa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +16. Refer to the figure answer the following questions. Alignment Hide Colors View Alignment File CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR--------VDIALECERYLAPK 50 -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK- MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 --WSDIAAECERFLGPM 52 :.. GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 Human_AA Oyster AA Corn_AA GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD-----ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. :::.:. : .*: *... DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG- -TPDSRLDWGPDMICSDDTOYSN--GRG 163 Human_AA Corn_AA :: * Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two II. one III. three IV. four b) What does the (*) mark mean in…ersonal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc={a6b083c9-a226-4c31... ☆ Search (Option + Q) Review View Help Picture Editing A В ... During nucleic acid hybridization, the probe is labelled Question 1 options: for DNA stability to increase probe-test DNA binding to identify the location of probe and the test DNA binding for amplification Question 2 6. 9. 10 IV 13 14 Which of the following best describes the trait in the pedigree? Question 2 options: X-linked dominant X-linked recessive autosomal domiant autosomal recessive ON
- TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT Write the amino acid sequence of the protein that would be formed by translating this plece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids, Use the abbrevlation of the amino adid exactly as Itswritten in the table (including the appropriate capltalizations For example it your answer for amino acid 1 is"Methionine" you would write MET in the box (not Met or met) Second Later UUU UUUC Phe UCU UAU Ser UAC UAA UAG Tyr UGU Cys U Leu UCA ucG UGC Stop uGA Beop UUG Step UGG Trp G Cuu C cuC CUA CUG CU Leu Coc CCA CG CAU Pro cGu CAC CAA CAG His CGC Arg CGA CGG 1st 3rd letter AUU A AUG AUA AUG ACU le AAU AAC AGU ACC Asn Ser U leBer ACC ACA Mct ACG The AAA AAG ACA Lys AGG Arg acu Val GCC GCA GCG GAU GAC GAA GAG GOU GGC GGA GGG Arp G GUC GUA GUG Ala Gly Glu Seovence of the protein, 1st amino acid. 2nd arnino acid: 3rd amino acid: 4th amino acid Sth amino acid: 6th amino acid: 7th amino…a) what si the nucleotide at the 5 prime end of the picture? b) what si the DNA sequence from 5 prime to 3 prime pls help, urgently required, no explanation neededDrill 3 Peptide Structure and Sequencing [Compatibility Mode] - Word File Home Design Layout References Mailings Review View O Tell me what you want to do... Sign in 2 Share Insert X Cut P Find - Tahoma - 10.5 - A A Aa - AaBbCcl AaBbC AaBbCcI AaBbCc) AaBbCcD AaBbC AaBbCcI AaBbCcl 自Copy akc Replace Paste B I U - abE X, X A aby Emphasis Heading 1 I Normal Strong Subtitle Title I No Spac. Subtle Em.- A Select- Format Painter Clipboard Font Paragraph Styles Editing 1 4 • 5. L. 6 . . 7 : I· 8 . I. 9. 10 . I 11 . L. 12 13 . . 14 . I 15 AI 16 L A sample of a peptide of unknown sequence was treated with trypsin; another sample of the same peptide was treated with chymotrypsin. The sequences of the smaller peptides are the following, deduce the sequence of the original peptide. 2. Met-Val-Ser-Thr-Lys Val-Ile-Trp-Thr-Leu-Met-Ile Leu-Phe-Asn-Glu-Ser-Arg Trypsin treatment: Asn-Glu-Ser-Arg-Val-Ile-Trp Thr-Leu-Met-Ile Chymotrypsin treatment: Met-Val-Ser-Thr-Lys-Leu-Phe 21 Page 1 of 3 231 words…
- 61 identify the primer 3' 5' a 5' 3' C e f a 5' 3' 3' 5' Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a a b b e f a Save UnansweredDrill 3 Peptide Structure and Sequencing [Compatibility Mode] - Word File Home Design Layout References Mailings Review View O Tell me what you want to do... Sign in 2 Share Insert X Cut P Find - Tahoma - 10.5 - A A Aa - AaBbCcl AaBbC AaBbCcI AaBbCc) AaBbCcD AaBbC AaBbCcI AaBbCcl ED Copy ac Replace Paste BIU - abe X, x aby Emphasis Heading 1 T Normal Strong Subtitle Title I No Spac. Subtle Em. - A Select - Format Painter Clipboard Font Paragraph Styles Editing 4 5 • 10 11 12 13 14 I Peptide Sequencing 1. A sample of an unknown peptide was divided into two aliquots. One aliquot wa treated with trypsin, and the other with cyanogen bromide. Given the followir sequences of the resulting fragments, deduce the sequence of the original peptide. Asn-Thr-Trp-Met-Ile-Lys Gly-Tyr-Met-Gln-Phe Val-Leu-Gly-Met-Ser-Arg Trypsin treatment: Gln-Phe Ile-Lys-Gly-Tyr-Met Ser-Arg-Asn-Thr-Trp-Met Cyanogen Bromide treatment: Page 1 of 3 231 words English (United States) 242% 1:56 PM File Explorer O My…Genetic Code-Reference Second Letter First Letter C Third Letter UAU] UACS **UAA Stop UGU] Cys UGC U UUU Phe UUC UCU Туг UCC U Ser UUA) Leu UUG **UGA Stop UGG Trp UCA UCG **UAG Stop CUU CCU CAU) CGU His CACJ CAA) CUC CCC CGC Leu Pro Arg CUA ССА CGA A Gln CUG CCG CAGJ CGG AAU] AGUSer U AUU ACU AACAsn AAA Lys AUC Ile ACC AGC C Thr AGA] Arg AUA ACА AAGJLYS GAU] GACASP *AUG Met/Start ACG AGG U GUU GCU GGU Asp GUC GCC GGC Val Ala Gly GAA) Glu GAGJ GUA GCA GGA GUG GCG GGG
- Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________Original DNA DNA Protein TACGCTATGAGC Methionine-Arginine-Tyrosine-Serine Mutation #1 DNA What type of mutation occurred? substitution insertion duplication deletion TACTCTATGAGCposition position (5' end) position (3' end) UUU Phe - F UUC Phe UAU Tyr Y. UAC Tyr UAA Stop UGU Cys UGC Cys UGA Stop UGG Trp UCU Ser UCC Ser U UUA Leu UUG Leu UCA Ser UCG Ser UAG Stop W 輔 CAU His CGU Arg CGC Arg CGA Arg CGG Arg CUU Leu CCU Pro CUC Leu CCC Pro P. CCA Pro CÁC His CỦA Leu CAA Gln CUG Leu CCG Pro CAG GIn AUU lle ACU Thr AAU Asn AGU Ser AUC lle ACC Thr -T ACA Thr AAC Asn_ AGC Ser AGA Arg AGG Arg A AUA lle AAA Lys EK AAG Lys AUG Met ACG Thr GUU Val GGU Gly GGC Gly GGA Gly GGG Gly GAU Asp D GAC Asp GCU Ala GUC Val -V GUA Val GCC Ala GCA Ala GCG Ala G - A GAA Glu FE GAG Glu GUG Val Nonpolar Polar Basic Acidic Stop codon Table 4.1 Biology: How Life Works, Third Edition © 2019 W. H. Freeman and Company Consider the DNA sequence–3'-CACTGGTAGCGA–5', • What is the sequence of the messenger RNA sequence that is transcribed from this DNA sequence? (Indicate the 5' and 3' ends of the RNA molecule.) • Consult the genetic code that is shown above. What is the amino acid sequence of the…