Figure Q3-1 The kelch repeat domain of galactose oxidase from D. dendroides (Problem 3-10). The seven individual B propellers are color coded and labeled. The 87 86 B1 85 N- and C-termini are indicated by N and C. B2 84 83

Figure Q3-1 The kelch repeat domain of galactose oxidase from D. dendroides (Problem 3-10). The seven individual B propellers are color coded and labeled. The 87 86 B1 85 N- and C-termini are indicated by N and C. B2 84 83

Name: The so-called kelch motif consists of a four-stranded β sheet, which f
Uploaded: 2024-03-20T06:42:41.000Z
Channel: Bartleby
Description: The so-called kelch motif consists of a four-stranded β sheet, which forms what is known as a β pro-peller. It is usually found to be repeated four to seven times,forming a kelch repeat domain in a multidomain protein.One such kelch repeat domain is

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter26: Synthesis And Degradation Of Nucleotides

Section: Chapter Questions

Problem 10P

See similar textbooks

Similar questions

A Leu →Ala mutation at a site buried in the core of the enzyme lysozymeis found to be destabilizing. Explain the observed effect of this mutationon lysozyme stability by predicting how enthalpy (ΔH°), conformationalentropy (ΔS°peptide), and the hydrophobic effect (ΔS°solvent) are expected to change for the mutant compared to wild-type lysozyme. Explain how ΔG°for unfolding is affected by your predicted changes in enthalpy or entropy.
A chain NH3 NH3 B chain Gly Phe 2. The protein pictured below is bovine insulin. Determine the number and the size of the fragments that would be generated upon treatment with the following: İle Val Val Asn Gln Gln 5 Ġln 5 His look for the cleavage points (a) without DTT and (b) with DTT. Cys Leu Cys S-S Cys Without DTT With DTT Ala Ģly Ser Ser Trypsin 10 Val 10 His Cys Leu Chymotrypsin Ser Val Leu Glu BrCN Tyr Ala 15 Gln 15 Leu Leu Тyr Ġlu Leu Ásn Val Тyr Cys 20 Çys 20 Gly Asn Glu Arg Reagent (source) Trypsin (bovine pancrease) Chymotrypsin (bovine pancrease) Staphylococcus V8 protease Pepsin (porcine pancrease) Cyanogen bromide (chemical)(CnBr) Specificity Lys, Arg (C) Phe, Trp, Tyr (C) Glu, Asp (C) Phe, Trp, Tyr (N) Met (C) Gly Phe 25 Phe Тyr Thr Pro Lys 30 Ála
Cell wall bullding block D-Ala-D-Alal-Lys-tail NH,Me Heptapeptide backbone R1 R. R2 ii) With the aid of the figure above showing the important features of the binding of Vancomycin (lower part) to a bacterial cell wall peptia discuss the antibiotic effect of Vancomycin. i) Vancomycin resistant strains often have a mutation in which one of the D-Ala moieties is exchanged to a D-lactate moiety. Discuss why this mutation makes the strain Vancomycin- resistant but still viable. iv) Glycoconjugate vaccines based on bacterial capsular polysaccharides have been used for 30 years without any need for changes in their structures, while the flu vaccine, based on attenuated or killed virus particles, requires many different structures and a check each time when there is an epidemic that the right vaccine is used. Discuss the reason behind this.
Mutational analysis of the important amino acids in the catalytic triad of serine proteases showed that replacing Asp102 or modifying His57 with amethyl group decreased the reaction rate about 5000-fold. However,mutating Ser195 decreased the reaction rate a millionfold. Discuss why mutating Ser had a larger impact than the other members of the catalytic triad.
Failure of anti-oxidant function results in the hydroxylation of an aromatic acid of Enzyme Z and its activation, so that it degrades protoporphyrin to porphyrin, an unstable product. When hit by light, this product further degrades to form a compound responsible for the lesions and excruciating pain the man suffers. The mutation also affected an amino acid at the N-terminal of Enzyme X. Sequencing of the first seven (7) amino acids at the N-terminal of the normal enzyme gave the following sequence: trp-arg-asp-leu-ser-gly-his When the cDNA was sequenced by the Sanger method utilizing ddCTP, the following products were obtained: Tetranucleotide Hexanucleotide Nonanucleotide Decanucleotide Dodenucleotide Octadecanucleotide Nonadecanucleotide 21-nucleotide What is the sequence of the bases in the mRNA coding for the peptide above?
Failure of anti-oxidant function results in the hydroxylation of an aromatic acid of Enzyme Z and its activation, so that it degrades protoporphyrin to porphyrin, an unstable product. When hit by light, this product further degrades to form a compound responsible for the lesions and excruciating pain the man suffers. The mutation also affected an amino acid at the N-terminal of Enzyme X. Sequencing of the first seven (7) amino acids at the N-terminal of the normal enzyme gave the following sequence: trp-arg-asp-leu-ser-gly-his When the cDNA was sequenced by the Sanger method utilizing ddCTP, the following products were obtained: Tetranucleotide Hexanucleotide Nonanucleotide Decanucleotide Dodenucleotide Octadecanucleotide Nonadecanucleotide 21-nucleotide The mutation involved the 19th bases of the template strand of the peptide. A comparison of the electrophoretic profile of the normal peptide (N) and mutant peptide (M) is shown below. The (+) electrode is situated at the bottom. pH…
Failure of anti-oxidant function results in the hydroxylation of an aromatic acid of Enzyme Z and its activation, so that it degrades protoporphyrin to porphyrin, an unstable product. When hit by light, this product further degrades to form a compound responsible for the lesions and excruciating pain the man suffers. The mutation also affected an amino acid at the N-terminal of Enzyme X. Sequencing of the first seven (7) amino acids at the N-terminal of the normal enzyme gave the following sequence: trp-arg-asp-leu-ser-gly-his When the CDNA was sequenced by the Sanger method utilizing ddCTP, the following products were obtained: Tetranucleotide, Hexanucleotide, Nonanucleotide, Decanucleotide, Dodenucleotide, Octadecanucleotide, Nonadecanucleotide, 21-nucleotide What is the sequence of the bases in the mRNA coding for the peptide above? The mutation involved the 19 bases of the template strand of the peptide. A comparison of the electrophoretic profile of the normal peptided (N) and and…
The protein fragments ABS1 and ABS2 of tropomodulin were produced as fusion proteins with chitin binding domain and purified by a chitin column. Explain the principles of this type of affinity chromatography and support it with a self‐drawn figure. This is with regards to Tropomodulin/ F-Actin complex.
The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by Edman degradation and have the sequence:AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK(a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein.(b) What are the cleavage sites using chymotrypsin?
Effects of BPA on phosphorylation of MAPKfamily in RAW264.7 cells conclusion
Proteinase K should be used as the first step of DNA purification (before applying phenol CIA mixture) to remove most proteins. Proteinase K alone cannot remove all proteins from the lysate. Explain why the Proteinase K enzyme cannot remove ALL proteins from the cell lysate.
The following amino acids that are often found inside globulin molecules are () A, Tyr B, Phe C, Asn D, Glu True of false 1. In the de novo synthesis of purine nucleotides and pyrimidine nucleotides, base rings are first synthesized and then corresponding nucleotides are formed with phosphoribose. () 2. Transcription is the process of transferring genetic information from DNA to RNA. DNA is synthesized under the catalysis of RNA polymerase, and the direction of synthesis is from the 5 'end to the 3' end. () 3. The change of protein conformation is caused by the breaking of covalent bonds within the molecule. () 4. In very high and very low pH solutions, amino acids exist mainly in non-ionic form. () 5. The active center of an enzyme usually consists of several amino acid residues adjacent to each other in the primary structure. ()