Q: Draw the structure of the a-keto acid formed by the transamination of each amino acid: (a) tyrosine…
A: arrow_forward
Q: The neural and hormonal control of the digestive system is divisible into three phases. Discuss the…
A: The digestive system includes the gastrointestinal tract and accessory digestive organs. The…
Q: what are the differant and similarites between TTX, STX and cocaine as pharmacological toxins
A: TTX (tetrodotoxin) fish toxin that blocks the pore of voltage-gated Na+ channels. saxitoxin (STX)…
Q: Describe the relationship between chromosomes, cells, and DNA 2. [Use Pictures] - How does…
A: The genetic information necessary for an organism to develop and operate is carried by the molecule…
Q: What does it mean when "Evolution is often circuitous rather than linear"? Explain in simple terms.
A: Introduction: The genetic makeup of a population changes through time, and this is what is meant by…
Q: 1. Definitions and brief statements 1. DNA Data Bank of Japan 2. MeSH Database 3. Please describe…
A: 1 DNA data bank of Japan -• An annotated collection of all publicly available nucleotide and protein…
Q: Describe the principle of CT scanning. Explain how coronal, sagittal and transverse images are…
A: Through computer processing, cross-sectional pictures (slices) of the bones, blood arteries, and…
Q: How does protecting and conserving a predator species increases the diversity in an area? Use the…
A: Predators contribute to the preservation of species variety in a community by diminishing the level…
Q: vaccines
A: Immune system: It is system of large network of organs,WBC, antibodies and chemicals. It works…
Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…
A: Peptide 1 is migrate most slowly during size exclusion chromatography
Q: Explain how E.coli. bacteria (prokaryotic species) and humans (eukaryotic species) reproduce? Design…
A: Introdiction:- Reproduction is a biological process by which an organism reproduces an offspring…
Q: If a post synaptic neuron is stimulated to threshold by spatial summation this implies that Select…
A: The nervous system is composed of millions of nerve cells called neurons. Synapses are junctions…
Q: 1.what does a slope if titration curve indicate? write down the functions of mixed indicators. 2.…
A: The science of chemical mechanism that occur within and relate to live beings is known as…
Q: Explain why trisomy X is not a lethal condition.
A: A female who has an additional X chromosome at birth is said to have triple X syndrome. It might be…
Q: Bacteriophage P22 was used in generalized transduction experiments to infect the Salmonella…
A: Transduction can be defined as a genetic engineering method that involves the insertion of foreign…
Q: 2. A 23-year-old Caucasian female presented to the emergency department (ER)with profuse watery…
A: INTRODUCTION - Diarrhoea is defined as passage of unusually loose or watery stools usually at least…
Q: What is the function of the sigma subunit of prokaryotic RNA polymerase? a. It directs the…
A: Introduction:- Transcription is defined as the process of RNA synthesis. It uses one strand of DNA…
Q: Electron microscopy of kidneys revealed tubules, which are lined by cuboidal epithelium. There are…
A: Connecting tubules and collecting ducts make up the collecting duct system. Arcades that drain…
Q: P₁ P₂ F₁ F2 3.3 days² 4.7 days² 6.6 days² 19.2 days² 12.1 days² a) Given the variances from these…
A: Heritability is the term used in breeding experiments in which one calculates the variation in any…
Q: Define reproduction. How does it help in providing stability to the population of species?
A: Introduction A population is a persistent group of an interbreeding individual of a species found…
Q: Which of the following is NOT a requirement for photosynthesis? Question 4 options: a)…
A: Photosynthesis is the process by which green plants and algae make organic food (glucose) out of…
Q: Thioredoxin is: oxidized, reduced activity causes the: inhibition, activation enzymes by: forming,…
A: Thioredoxin reductase are important redox proteins which regulate the balance generated in…
Q: 3. You have a protein that is easily extracted from a cell membrane preparation, without any…
A: INTRODUCTION : Cell membrane : It is also known as the plasma membrane, which is present in all…
Q: During an experiment, a virus is isolated from clinical samples. Electon microscopy shows that it…
A: The structure, replication strategies, and hosts that viruses infect differ among viruses. Most…
Q: A patient with poliomyelitis (which characterized by spinal cord damage) has disorder of skeletal…
A: Neurons are cells that transmit information in the form of electrical and chemical signals. They are…
Q: "The design of trans-Tango is modular, so it is not limited to tracing experiments. Since the…
A: It is certainly possible to further advance the trans-Tango system to label third-order neurons,…
Q: Nitrobacter and Nitrosomonas are sensitive to wide range of environmental factors. Which…
A: Biological nitrogen fixation is carried out by a highly conserved complex of proteins called the…
Q: In your own words explain endomysium and its function
A: Tissue is a group of cells that have a common origin and functions together to form specialised…
Q: 2. What happens when large natural and/or man-made deforestation occur?
A: 2. Deforestation is known as the purposeful clearing of forested land. Throughout history & into…
Q: A 40 year old man with a compliment deficiency agrees to participate in a clinical study of immune…
A: A class of autoantibodies known as C3 nephritic factors (C3NFs) allow for ongoing overactivation of…
Q: POTENTIAL IMPACT OF "Land use effect on benthic micro-invertebrate communities in streams".
A: Land use is a major global concern because the disturbances caused by it result in soil erosion,…
Q: Aside from hydration, pick two ways water's extraordinary properties affect living organisms.…
A: Water has a lot of essential properties that support life. It is also known as the universal…
Q: name two organism in which external fertilization take place .
A: Fertilization is a process in which two gametes fuse together which results in new individuals.…
Q: Which of the following cell types can directly regulate B cell activation and differentiation? 單選:…
A: The stimulation of the Th1 clones with immobilised anti-CD3 mAb greatly boosted the proliferation of…
Q: or the cactus (eukarotic) and the e coli bacteria (prokarotic) i want you to: Classify them based…
A: With the aid of dichotomous keys, it is possible to recognize patterns more easily. It helps to…
Q: What are the structures of Plasmids and Transposable elements in microbes?
A: Plasmids are circular, extrachromosomal DNA molecules that are separate from the chromosomal DNA.…
Q: From one molecule of glucose, what is the net yeild of ATP molecules produced through glycolysis and…
A: Aerobic cellular respiration mainly consists of four steps glycolysis, pyruvate oxidation, the…
Q: a- Select a plant that you eat regularly and mention its scientific name. How do we name the…
A: We have access to a wide variety of fruits and vegetables every day, including kiwi, apples, and…
Q: origins of neurodevelopmental disorders such as autism
A: Genome-wide association studies (GWAS) have been instrumental in uncovering the genetic basis of…
Q: Explain the additional health risks to a patient undergoing a CT scan as compared to an ordinary…
A: A CT (computed tomography) scan may more effectively capture bones and arteries all at once than an…
Q: What is the study of microorganisms
A: Microorganisms are tiny living things that cannot be seen with unaided eyes due to their small size.…
Q: Highlight how cell signalling is terminated at the level of receptor binding, G protein activation…
A: introduction G proteins regulate metabolic enzymes, ion channels, transporter proteins, and other…
Q: 15. The majority of blood vessels that carry blood towards the heart are: a) Veins b) Capillaries c)…
A: Blood vessels are circulatory system components that convey blood throughout the human body. These…
Q: Which of the following is likely to happen in a muscle cell in an anaerobic environment? Question…
A: During a glycolytic pathway, a glucose molecule is enzymtically degraded, producing either two…
Q: CD1 binds to 單選: A. MHC class II. B. polysaccharides. C. lipids. D. peptides. E. MHC class I. O O O…
A: The majority of cytotoxic T cells have T-cell receptors (TCRs) that can identify a particular…
Q: 1. Why is the red blood cell number in males more than in females? Is there a difference between…
A: Introduction : Red blood cells are also referred to as erythrocytes. They make up a significant…
Q: What is the main source of energy for ATP replenishment for Cellular Respiration?
A: Introduction ATP or adenosine triphosphate is known as energy currency of cell. All living…
Q: Muscles of the myometrium don't contract sufficient in the woman during childbirth. This is…
A: In females, the hollow muscular organ located in the pelvic region between bladder and rectum where…
Q: Typically, tropical plants have a higher stomatal density (# stomata/leaf area) when compared to…
A: Plants are living organism which carries out the process of photosynthesis and hence prepare their…
Q: What are the importance of sequence homology in strand invasion? Explain and answer this…
A: Sequence homology is an important concept in strand invasion, which plays a vital role in the…
Explain the following:
- discuss how language played as a vital part in human evolution.
- what development shows a big difference between homo sapiens and earlier homini species? discuss.
Step by step
Solved in 2 steps
- Adaptations are physical or behavioral traits that help an organism survive in its environment. What are some of the adaptations in the evolution of hominins that allowed for the evolution of the genus Homo to evolve (eventually) into modern humans (Homo sapiens)? (Note: you don’t have to explain why these adaptations allowed the genus to evolve, just list some of the adaptations.)Write briefly about the "hobbit" species of hominin. What are the theories about its evolution? What was the species like? When and where did it exist? (Homo floresiensis)what development shows a big difference between homo sapiens and earlier homini species? discuss.
- What do you think about the hypothesis that language evolved as a way for early hominins to communicate about stone-tool manufacturing? What other hypothesis could you come up with as to why language evolved in our Hominini tribe?The first modern humans evolved in Africa. a) What are two kinds of evidence supporting that conclusion, one based on data from living individuals and one from some other source of data? b) What are some unique anatomic and behavioral traits that are unique to hominid species compared to primates, and to Homo sapiens in particular, compared to other hominid species?Describe three derived characteristics of mammals which are advantageous to the occupation of a variety of habitats. Identify three novel characteristics that distinguish hominins from other apes and mammals.
- Answer the Following: 1. Justify why A. afarensis is a type of hominid. 2. Why are chimpanzee behaviour studies important for our knowledge of early hominids? 3. What derived traits did Homo erectus and modern humans have in common? which derived characteristics are specific to H. erectus?Describe some of the key characteristics of Homo habilis - the first species in our genus "homo". What traits set this species apart from earlier hominins? e.g. Brain size? What kind of tools did they make? when did they live? diet? etc. Include a personal reflection on what stood out to you about Homo habilis.We have studied how the six major primate groups evolved, with the most recent group being the hominins.The hominins branched off from main ape group around 7 million years ago.According to our lessons explain your reasoning as to whether there is a missing link,or one single specimen that embodies both ape and hominin traits, that serves as a transition between what is clearly ape and what is clearly hominin?What have you found most interesting about the beginning of hominin evolution and why?
- Describe and discuss the importance of at least three specific skeletal features (these can be either cranial or post-cranial) that are unique to early hominins, that distinguished them from the ancestors of modern chimpanzees in 150 words?According to "Homo naledi – New Questions on Human Evolution ", why was it significant that the bones were found to be articulated (their bones hadn’t separated from each other)? A.The individuals arrived in the cave either alive or shortly after the died. B.The individuals had decomposed outside of the cave, and other Homo naledi individuals put their skeletons together inside the cave. C.The bodies must have been placed in bags or coffins to keep the skeleton together as the body degraded. D.None of these are correctThroughout this class, we have reviewed important physical and behavioral traits that are used to define and distinguish hominins from each other. What do you think it means to be human? Would you include any physical or behavioral traits in your definition? Write at least 2 complete sentences.