Describe various factors that affect plant growth (e.g. growth regulators, sunlight, nutrients, water, tropism), and explain by giving example, why some plants can live in the forest although they might not be exposed to the sun ‘no sunlight can reach them’.

Describe various factors that affect plant growth (e.g. growth regulators, sunlight, nutrients, water, tropism), and explain by giving example, why some plants can live in the forest although they might not be exposed to the sun ‘no sunlight can reach them’.

BIOLOGY:CONCEPTS+APPL.(LOOSELEAF)

10th Edition

ISBN:9781305967359

Author:STARR

Publisher:STARR

Chapter26: Plant Nutrition And Transport

Section: Chapter Questions

Problem 5SA: The nutrition of some plants is enhanced by a mutually beneficial association between a root and a...

See similar textbooks

Related questions

Q: Explain silent, induced, and spontaneous mutations and explain how harmful they are.

A: A mutation is a change in our DNA sequence that happens as a consequence of DNA copying errors or…

Q: Types of GSD 2- Types of GSD:Please indicate the definition of each typ.e and its cause a. I b. II…

A: A Cell is the smallest basic but utmost important component of all biological organisms. It performs…

Q: ANswer the questions related to animal nutrition: a. In poultry feed formulation, why is the ME…

A: a.In animal husbandry poultry farming mainly raises domesticated birds such as…

Q: Single and double digestion of plasmid pMCS326 were performed using the restriction enzymes AluIII…

A: Restriction mapping is a technique for mapping an unknown section of DNA by breaking it apart and…

Q: Give me a evidences for debate marijuana a gateway for other drugs

A: Introduction:- Drugs are chemical substances which are used to diagnose, prevent and treat various…

Q: Which of the following is a very weak and temporary bond that allows for chemical signaling in…

A: Chemical bonds are the forces of attraction that hold the atoms or ions that make up a molecular…

Q: 7. Which kingdom contains organisms that have no nuclear membrane? a) Eubacteria b) Protista

A: Nuclear membrane is a layer that surrounds the nucleus of a cell and plays an important role in…

Q: Phenomenon of "coated tongue" was revealed in the patient with chronic gastritis during external…

A: The tongue appears to have a white coating due to a condition known as coated tongue, also known as…

Q: 1. Briefly describe the lytic cycle and lysogenic cycle of bacteriophages.

A: Viral replication is facilitated by the lytic cycle and the lysogenic cycle. The virus does this…

Q: Describe the inside of hyphae

A: Hyphae are produced by fungi. These are long and have branching and can be seen in number of…

Q: Which of the following methods is the best way to sterilize the apparatus used in a surgical…

A: Sterilization is a procedure used to destruct all types of microbes (bacteria, viruses, fungi). The…

Q: 6. In a healthy person, which of the following cells is the most numerous innate immune cells in the…

A: The most numerous and crucial biological component of the innate immune response is the neutrophil,…

Q: 2. A 23-year-old Caucasian female presented to the emergency department (ER)with profuse watery…

A: INTRODUCTION - Diarrhoea is defined as passage of unusually loose or watery stools usually at least…

Q: Acid value, iodine value and saponification value (also known as acid value, iodine value and…

A: Saponification is important to the industrial user for it helps to know the amount of free fatty…

Q: or the cactus (eukarotic) and the e coli bacteria (prokarotic) i want you to: Classify them based…

A: With the aid of dichotomous keys, it is possible to recognize patterns more easily. It helps to…

Q: 1. Definitions and brief statements 1. DNA Data Bank of Japan 2. MeSH Database 3. Please describe…

A: 1 DNA data bank of Japan -• An annotated collection of all publicly available nucleotide and protein…

Q: List the. Functions performed by pancreas inour body

A: The pancreas is a large gland present in the human body. It is located behind the stomach. Its main…

Q: III. Go to the NCBI home page. Answer the following questions using keyword "Helicobacter pylori" to…

A: Helicobacter pylori is bacterium which usually infect the stomach of humans. In stomach, these are…

Q: If the DNA sequence below were prepared using solid-phase DNA synthesis using the phosphoramidite…

A: Nucleic acids are "proteins that are essential to the structure and operation of all living cells.…

Q: Two groups of patients are recruited for an experiment. Group 1 patients are given compound X and…

A: Pituitary gland is a pea-sized gland located at the base of brain. The main function of this gland…

Q: What's pharmacotoxicologie

A: In biology there are different sections to study with a number of individual functions and…

Q: Explain how cactus (eukarotic) reproduce?

A: Cacti are a diverse group of succulent plants that can be found in many different climates, ranging…

Q: The neural and hormonal control of the digestive system is divisible into three phases. Discuss the…

A: The digestive system includes the gastrointestinal tract and accessory digestive organs. The…

Q: What characteristics does yeast have that makes it a beneficial microbe for wine, bread, juices, and…

A: Yeast is a eukaryotic ,single celled microorganisms.It belongs to Kingdom fungi,and phylum…

Q: What would be the effect of increased (or decreased) concentration of extracellular Ca2+ on the…

A: "Neurotransmitters can serve as chemical messengers for ion channels, neurotransmitter mainly causes…

Q: what are the differant and similarites between TTX, STX and cocaine as pharmacological toxins

A: TTX (tetrodotoxin) fish toxin that blocks the pore of voltage-gated Na+ channels. saxitoxin (STX)…

Q: Neurulation in model vertebrates and in fly follows soon after gastrulation. Do vertebrates and…

A: "The development of the nervous system is a complex process that occurs during embryonic development…

Q: After a particular cell is moved from a saltwater solution to a freshwater solution, it explands. We…

A: A solution is made up of two components which are; Solute Solvent The solvent is generally a…

Q: T T' t t' Y Y' y y' L L' I I' G G' bo g' Suppose the single strand breaks in the figure initiated an…

A: Recombination is a process by which pieces of DNA are broken and recombined to produce new…

Q: In which type of plants are Nitrogen fixing bacteria present

A: Nitrogen (N2 ) is one of the important gas presents in the atmosphere. This form of nitrogen is…

Q: A loss-of-function mutation in the ion channel responsible for the generation of end-plate…

A: Please follow step 2 for detailed expalanation.

Q: Choose the option that is best described by each of the following statements 1 1. Attacks the…

A: Enzymes are the biocatalyst which increases the rate of chemical reaction,without itself being used…

Q: e surface of each B cell clone. 選: Affinity maturation Allelic exclusion Negative selection Somatic…

A: Antibodies are the specific proteins that is the part of humoral immune response formed by the B…

Q: Explain the management of non-haemorrhagic stroke in detail?.

A: Stroke is a medical condition in which there is interruption in the blood supply to the brain.…

Q: What are the current clinical trials for treating malaria disease?

A: Malaria infection is associated with fever with chills. It is caused by a protozoan called…

Q: A histological specimen of kidney shows a structure which consist of a glomerulus with fenestrated…

A: Kidneys These are bean shaped brown organs that are responsible for performing vital functions such…

Q: Highlight how cell signalling is terminated at the level of receptor binding, G protein activation…

A: introduction G proteins regulate metabolic enzymes, ion channels, transporter proteins, and other…

Q: -O 10 11 12

A: Pedigree is a family chart showing the inheritance of a particular trait through several generations…

Q: i was thinking about A

A: Attentional control refers to control someone's attention towards a specific topic . It is very…

Q: 25. Which one of the following is not true about chaotic population dynamics? a. Chaotic dynamics is…

A: The population stabilises pretty quickly at low growth rates. The population oscillates chaotically…

Q: If a post synaptic neuron is stimulated to threshold by spatial summation this implies that Select…

A: The nervous system is composed of millions of nerve cells called neurons. Synapses are junctions…

Q: What are types of gene mapping?

A: Finding genes inside a genome is referred to as gene mapping. Scientists are typically very…

Q: Describe how a nerve impulse initiates muscle contraction

A: Movement is caused by muscles that are connected to bones. Muscle contraction can be considered the…

Q: What effect will a decreased heart rate have on blood pressure?• What relationship will water volume…

A: Blood pressure is a measurement of the power used by your heart to circulate blood throughout your…

Q: Please help me with these! Please leave me a paragraph of minimum 500 words with many informations…

A: Schizophrenia is a persistent, severe mental illness that has an impact on a person's relationships…

Q: 10. The animals being raised in CAFOS get their than them and roaming to find food. 11. With the…

A: The livestock sector plays a significant role in the world's food system, helping to reduce poverty,…

Q: The best studied of the mass extinctions is the Cretaceous extinction. Why do you think it has been…

A: The mesozoic era began with the Triassic period and ended with the Cretaceous period. The Cretaceous…

Q: Search for actual mutations that happened to cactus and answer these questions: step 1: where did…

A: We all know that plants can grow whole life.The basic meaning of growth is the increase in the…

Q: Thioredoxin is: oxidized, reduced activity causes the: inhibition, activation enzymes by: forming,…

A: Thioredoxin reductase are important redox proteins which regulate the balance generated in…

Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…

A: Peptide 1 is migrate most slowly during size exclusion chromatography

Question

Describe various factors that affect plant growth (e.g. growth regulators,
sunlight, nutrients, water, tropism), and explain by giving example, why some
plants can live in the forest although they might not be exposed to the sun ‘no
sunlight can reach them’.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Definition

VIEW

Factors that affect plant growth

VIEW

The ground layer of the forest

VIEW

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Phytoremediation is the utilization of plants in the clean up of a polluted area. In a maximum of four sentences, using a flow chart for illustration, outline the process of phytoremediation. Please include a picture of the flow chart.
Xerophytic plants are well adapted for very wet conditions. True False Which types of soils usually have reduced supplies of macronutrients (carbon, oxygen, hydrogen, nitrogen, etc.)? neutral soils (pH 7) slightly basic soils (pH 8-9) strongly acidic soils (pH 4-5)
To explain: The reason of plant wilting using cohesion theory of water transport.
Which of the following statements are true regarding tracheids and vessel elements? Select all that apply. Both tracheids and vessel elements are cells of phloem. Tracheids and vessel elements have to be alive in order to transport water. Vessel elements have perforation plates but tracheids do not. Both tracheids and vessel elements are specialized for water conduction. Both tracheids and vessel elements have pits.
Propose an experimental design to study the role of phytohormones in the maintenance or destruction of chlorophyll. You have access to the following chemicals and instruments/equipment: cork borer, scissors, pet dishes, kinetin, benzyl adenine, gibberellic acid, indole acetic acid, organic solvent, analytical instruments in the laboratory.
An environmental factor that makes it possible for roots to grow deeper into the soil Light intensity Gravitational force Air supply None of the above
Given three environmental factors, what are its infuence in the rate of transpiration in the plant? Environmental Factors Effect Explanation Light Wind / Air current Humidity
Phytoremediation is the utilization of plants in the clean up of a polluted area. Indian Mustard, Willow, Poplar Tree are plants utilized in phytoremediation. Identify and explain the pollutants each of the plants Indian Mustard, Willow, and Poplar Tree can handle.
A study was conducted on the impact of phytohormones on medicinal stem explants.The stem explants were cultured onto MS media containingdifferent types of phytohormones as listed in Table below. Predict the resultsobtained after 4 weeks with justifications and conclude the results youpredicted
B) Describe the mechanisms employed by two types of plants to minimize photorespiration and ensure that the CC is carried out even when environmental conditions are not in their favor. Be sure to identify 1) the type of plant, 2) its natural environment and how it affects the plant's ability to perform the CC, and 3) how it has adapted itself to minimize photorespiration. 4
The nutrition of some plants is enhanced by a mutually beneficial association between a root and a fungus. The association is known as _________. a. root nodule c. root hair b. mycorrhiza d. hypha
Vernalization is a plant response to: Light Gravity Physical contact None of the above Plant epidermis secretes a waterproof substance called: Cuticle Wax Periderm covering Pectin Plant transpiration accounts for what % of atmospheric water vapor? 50% 90% 5% 75%