Dendrites have diameters of _________ and lengths of __________? 0.20-80microns, 600-50000microns 0.2-8microns, 60-5000microns 0.8-18nanometers, 6-5nanometrs 1-2 angstroms, 4-5 angstroms

Dendrites have diameters of _ and lengths of __? 0.20-80microns, 600-50000microns 0.2-8microns, 60-5000microns 0.8-18nanometers, 6-5nanometrs 1-2 angstroms, 4-5 angstroms

Fundamentals of Sectional Anatomy: An Imaging Approach

2nd Edition

ISBN:9781133960867

Author:Denise L. Lazo

Publisher:Denise L. Lazo

Chapter1: Introduction

Section: Chapter Questions

Problem 21RQ

See similar textbooks

Related questions

Q: (True/False) Scientists have now been able to use the genomic data to determine whether a particular…

A: Genes" are the fundamental unit of heredity. They store genetic information in the form of DNA,…

Q: how does the xanthophyll cycle mediate dynamic photoinhibition?

A: Xanthophyll are carotenoid pigments containing oxygen and are responsible for the color of fruits,…

Q: Federal government guidelines issued in 2000 tell Americans to “choose lean meat,” where they…

A: Lack of interest in compiling such a study in the 2000 election year must have been a more…

Q: Describe the natural defence mechanisms used to protect individuals from urinary tract infections…

A: Urinary tract infections (UTIs) are one of the great concerns in the medical field as well as in…

Q: Match the organism on the left with virulence factors on the right. Treponema palladium…

A: VIRULENCE FACTORS = These are the factors produced by microorganisms which can cause disease and…

Q: Explain whether both v-SNARES and t-SNARES are essential for the homotypic

A: The fusing of vesicles involves a large number of protein molecules. Bringing two lipid bilayers of…

Q: Label the structures in the following illustration of a synovial joint. (a). (d) b с d

A: We know that The skeletal system is the arrangement of the bones that offer structural support for…

Q: QUESTION 1 Inhibitory local, inhibitory distant, excitatory local, excitatory distant and…

A: Neurons These are nerve cells and are the basic unit of the brain. These cells use electrical and…

Q: 2. In what types of diseases have MSCs been used to modulate the immune response?

A: Multipotent stem cells known as mesenchymal stem cells (MSCs) may develop into a number of cell…

Q: In humans, having freckles (F) is dominant to not having freckles (f). The inheritance of these…

A: A trait is a characteristic feature that is unique to particular individual. Each trait is…

Q: The following is a map of four genes on a chromosome. ( the image is displayed below) Between…

A: Recombination is a process by which pieces of DNA are broken and recombined to produce new…

Q: 11. The immediate source of energy for DNA replication is (a) the hydrolysis of nucleotides with…

A: DNA replication is the process by which a double-stranded DNA molecule is copied to produce two…

Q: 8 Phenylketonuria (PKU) is one of the most common recessive genetic disorders in humans. Infants…

A: The phenylketonuria is encoded by the p gene. It is recessive to dominant allele (P).

Q: Entropy increase A) with every reaction B) only in open systems C) only under certain reaction…

A: A system in a chemical reaction includes all the reactants and products. It is a defined condition…

Q: Butterfly A mates with Butterfly B. What are the genotypes of the two P generation butterflies if…

A: Introduction The term "genotype" refers to an organism's whole gene pool, or, in other words, the…

Q: Complications of influenza infection include Check All That Apply pneumonia as a result of secondary…

A: Influenza, also referred to as "the flu," is a contagious illness brought on by influenza viruses.…

Q: Which type and speed of slow axonal transport moves distinct polypeptides to the neuronal periphery?…

A: Axonal transport involves the movement of organelles and molecules to and from the cell body of…

Q: if we extract rna from a pool of cells that will that impact sequencing?

A: DNA Sequencing The process of DNA sequencing helps us determine the exact sequence of DNA that might…

Q: Please show work as well

A: In pea plant, the dominant colour Yellow(Y) and green (y) and for shape Round(R) and wrinkled(r)…

Q: Which of the following is NOT an appropriate use of DNA Sequencing data. a. Comparing the…

A: DNA sequencing refers to the process of identifying the base sequence of DNA. It uses sophisticated…

Q: In next-generation sequencing, which of these advances allows for massively parallel sequencing?

A: Ans : Next Generation Sequencing (NGS) is the genome sequencing technology where we can determine…

Q: A fox's diploid number of chromosomes is 36. How would the number of chromosomes in the fox's body…

A: The cell is the basic unit of life and it contains the genetic material in the DNA. The DNA is…

Q: Two major clades are revealed by the tree. List the species in ch clade. What can you say in general…

A: clade 1 - terrapin, black knobbed, ovachita, ringed, yellow botched clade 2 - para caogola, pearl…

Q: Choose the best answers for each missing word from the list below. (1)________ is a first messenger…

A: G protein coupled receptors are the type of cell surface receptors that are involved in signal…

Q: What function do alveolar macrophages serve What would happen to the respiration of an individual…

A: alveolar macrophages are the immune cells present in the luminal surface of the alveolar space in…

Q: PKU Worksheet Read the following paragraph about a genetic disorder identified as an inborn error…

A: Genetic disorder: When there are single or multiple abnormalities in the genome, it can lead to…

Q: Figure 10.9 Pedigree of ear lobe trait. Affected individuals have attached ear lobes while…

A: In terms of genetics, a pedigree shows how a trait or medical condition is passed down through a…

Q: 1. Why is micro spurge being used in mammalian bioreactor instead of a ring Spurger? 2. What will…

A: Bioreactor It describes a equipment that promotes a biologically active environment. It is a…

Q: How does the poly-A tail on mRNA assist with cDNA strand synthesis?

A: Introduction : cDNA refers to the DNA that has been isolated from the mRNA (Complementary DNA). The…

Q: Use this mRNA coding sequence as your starting point. This sequence begins with a start codon and…

A: A frameshift mutation in a gene is when nucleotide bases are added or removed in increments that are…

Q: 3. IL-10 induces upregulation of which M2 macrophage subtype? What role does this subtype play in…

A: Macrophages are the immune cells which participates in innate host defense mechanism as well as in…

Q: 12. Name the 4 types of papillae and describe each one.?Asap

A: Tongue is one of the most important sensory organ,which senses the taste of the substance and send…

Q: During cell division, centromeres have separated, and chromatids are pulled apart, becoming…

A: When eukaryotic cells divide, their chromosomes separate, a process known as mitosis occurs. During…

Q: questions, and test hypotheses. 1. Explore the background and historical depth to understand why…

A: Research is an important subject for understanding the overall process and exposure occurring around…

Q: Which of the following is NOT a ribonucleoprotein (protein-RNA complex)? Select an answer and…

A: Option (b) - RNA polymerase II is not a ribonucleoprotein. RNA polymerase II is an important…

Q: The nuclear lamina associates with ... Select an answer and submit. For keyboard navigation, use the…

A: Question: The nuclear lamina associated with..... Answer: Both the inner and outer nuclear envelope.

Q: A chiasma (plural = chiasmata) is (check all that apply): a physical connection between linked genes…

A: The examination of a human or another organism's entire DNA (containing all of its genes). An…

Q: Assume a single base in a RNA virus has a mutation rate of 1/1000 per generation. Over the course…

A: If a random variable has binomial distribution with number of trials n and probability of each…

Q: What evolutionary advantage does tight oligodendrocyte myelination in the brain provide and which…

A: Myelination It is a process through which brain oligodendrocytes create layers of myelin that wrap…

Q: Explain the reason why these viruses encode their own special fusion protein rather than making use…

A: The presence of the big proteins known as SNAREs on the vesicle facilitates the fusing of the…

Q: What is the function and structure of the blood-brain barrier? restrict exchange between blood…

A: Our brain is made up of different types of neuroglia cells and neurons. Neuroglia are responsible…

Q: A non-dividing yeti skin cell is shown to the right . In yetis, n = 0000 OHN T 0 2 우수 а ---- B

A: Cell is the building block of the body. It is basic structural and functional unit of life.

Q: In next-generation sequencing, which of these advances allows for massively parallel sequencing?…

A: The parallel processing sequencing technology known as "next-generation sequencing" (NGS) provides…

Q: Question 24 If the cell has a mutant nonfunctional CDC25, where does it arrest? O O G2 G1 M

A: A cell has four distinct phases in the cell cycle; which are called Interphase (G1), synthesis or S…

Q: Which of the following single stranded DNA oligonucleotides alone would be expected to spontaneously…

A: DNA is a double stranded structure in which each strands are made up of nucleotides. Nucleotide is…

Q: Explain how the loss of AP3 causes a defect in melanosomes.

A: Specialized lysosomes called melanosomes are where the pigment is kept. They possess unique…

Q: At what percentage can dehydration compromise physical performance?

A: Dehydration It occurs when an individual use or loses more fluid than consuming it. The body does…

Q: I need help with a biology question, please see the image below, thanks Answer the following…

A: On either side of the equatorial plate during metaphase I, homologous pairs of chromosomes align.…

Q: on ni aliuzen en B. Gene A contains a base substitution that results in a nonsense mutation. HTW…

A: A non sense mutation is the one where a codon is converted to stop codon and there is premature…

Q: Inhibitory local, inhibitory distant, excitatory local, excitatory distant and neuromodulatory are…

A: Axon is a long, thin fiber that extends from the cell body of a neuron and transmits nerve impulses…

Question

Dendrites have diameters of _________ and lengths of __________?

		0.20-80microns, 600-50000microns
		0.2-8microns, 60-5000microns
		0.8-18nanometers, 6-5nanometrs
		1-2 angstroms, 4-5 angstroms

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

______ Can Separate Particles and Molecules That Differ in Mass or Density.
which structure is highlighted in blue
Identify the structures from Figure (a) and (b) on a model or chart.
A patient undergoing an MRI is surrounded by a tubeshapedscanner. What is the function of magnets in an MRI?
1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing the membrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SF Chimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 S region, whose sequence is as follows: MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFAS TEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKH TPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRV QPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCV…
Which of the following structuresthat is highlighted
Identify the image shown in the picture 88 te 林

How many angstrom would be in 5 μm? Question options: 50 500 5000 50000
Consider a bi convex lens with radius of curvatures |R1| = 30 mm and |R2| = 180 mm, ct = 5 mm and glass is N-BK7. This is used as camera lens in order to image a man who is at 1 km away from the camera. We want to resolve 10 cm on his body. Assume that λ = 550 nm. Using zemax, determine the MTF value for the resolution of R = 80 lp / mm in image plane which is placed at paraxial focus. (Hint: First, find the diameter of the lens) Which one: a.32.1 % b.28.7 % c.12.3 % d.58.5 % e.46.8 % f.57.2 % g.20.9 % h.15.6 %
Milligrams 47.0 milligrams = Multiple Choice 0.47 decigrams 4.7 centigrams 0.047 grams 0.00047 hectograms All of the answer choices are correct.
A 43 gram tube of cream contains 19 mg of a drug. What is the percent strength of the drug in the cream? Round you answer to the nearest hundredth of a percent. ANSWER: [____]% w/w
Science Games and Puzzles Crossword Puzzles Name: Date: Cells Crossword Puzzle (cont.) ypethenn Directions: Complete the crossword puzzle below. the previous page using the clues and word bank Across Word Bank 1. jellylike substance within the cell one of many tiny structures in the cytoplasm; each photosynthesis cell does a specific job for the cell 7. traps light and is used to produce food for plants 9. spherical body within the nucleus 10. "powerhouse" of cell 12. holds nucleus together (2 words) controls entry into and out of cell (2 words) 16. stores food or contains pigment 17. hollow cylinder that supports and shapes cell 18. digestion center 5. organelle vacuole ribosomes plastid nucleolus nuclear membrane 15. mitochondria microtubule lysosome Golgi bodies endoplasmic reticulum cytoplasm chromosomes chloroplasts chlorophyll cell wall Down 1. contains the code that quides all cell activities 2. chromosomes are found here 3. surface for chemical activity (2 words) 4. where…