Coronavirus from bats to animals, sequence comparison: Note: dots mean amino acid is the same as the one in the top sequence. Human Virus AGNNPLQTYVIACQDGGERRAAQDMFSAKKGGQTPAYWGC Civet Cat Virus G..... ......K....E.....R. .W. Pangolin Virus GA.Q....W..G....C.L..V.E....Q.. Bat Virus B Bat Virus AG .A.Q....W..G....C.L.. .....K. Y.. .N.G.T.A .2.. .N.G.T.A .R.......Y.. A researcher isolates a coronavirus from humans that they believe came from Bat virus A or Bat virus B. They also think the virus may have first gone through pangolins or civet cats. Shown above is an amino acid sequence comparison in the region of the virus spike protein that binds to the cell receptor. All viruses are compared to the human virus with colored dots indicating the same amino acid at that position and letters representing the amino acid change at the particular position. Answer the questions below using the figure. Question 1 (3 points). Does this data support the idea that the human virus is derived from a bat virus that that first went through one of the animal hosts? Explain briefly. Question 2 (2 points). Based on this information, which virus is the most likely to have been the closest ancestor to the human virus? Explain briefly.

Imagine that a colleague asks you to align a conserved spike protein-coding gene sequence from SARS-CoV2 virus (Severe acute respiratory syndrome-related coronavirus variant 2) to its homolog (i.e., equivalent spike protein-coding gene sequence) in the MERS virus (Middle East respiratory syndrome-related coronavirus). Which sequence type - nucleic acid (DNA or RNA), or protein - would you expect to exhibit the highest percentage of identities? Why?

Please explain why or why not

RNA was extracted from certain virus and found to contain 35% cytosine. With this information, is it possible to predict what percentage of the bases in virus are adenine? If so, what percentage? If not, why not?

Please answer fast What is the sequence of the coding region of sars cov 2 virus's spike protein ?