B, CThe equations are in the other page. Thanks 1. A recent preprint article e reported pre-clinical evaluations of an inactivated Newcastle disease virus (NDV) chimera stably expressing themembrane-anchored form of the SARS-CoV-2 spike region (NDV-S) as a potent COVID-19 vaccine in mice and hamsters. To design the SFChimera, researchers combined the transmembrane domain and cytoplasmic tail of NDV F protein with the ectodomain of the SARS-CoV-2 Sregion, whose sequence is as follows:MGILPSPGMPALLSLVSLLSVLLMGCVAETGTQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNEVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPSGAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSSGNCDVVIGIVNNTVYDPLOPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKGSGRENLYFQGGGGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGHHHHHHHHA. Using the equation on Slide 5.3 of Module 1, Lesson 2, calculate the extinction coefficient (without disulfıdes, in Mcm 1) at 280 nmfor this protein. Show all of your work.B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be partof an a- helix, ß sheet, a reverse turn, etc.?) Explain why."Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the aminoacid sequence make it more likely to be part of a type of secondary structure to receive full credit.1: TNVVIKVC2: SAIGKIQD3: SETKCTLK4: INLVRDLP5: VLHSTQDL6: KIADYNYKC. If you wanted to covalently attach a single fluorescent label to this protein, what are two types of reagents would you use? Be sure togive specific examples, provide details about the chemical mechanism, and explain your choice. EquationsSide S.3.Ea80 (M-' cm-1) == (5500 x nerp) + 1470 x nar) t (125 + nos)Şide li10R- COOH = RC00 + HtK = [RCO0] + [H*][RCOO H]KX acidic[H*]%3D[H*][H*]Slide 1.8pI = ţ Cpk; + pK;)pl(pkit pka)I (pke+ pKz)

"Since you have asked multiple questions, we will solve the B question for you. If you want a…

B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be part of an a- helix, B sheet, a reverse turn, etc.?) Explain why. "Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the amino acid sequence make it more likely to be part of a type of secondary structure to receive full credit. 1: TNVVIKVC 2: SAIGKIQD 3: SETKCTLK 4: INLVRDLP 5: VLHSTQDL 6: KIADYNYK

B. For each of the following amino acid sequences in the protein, predict the most likely secondary structure. (Is it more likely to be part of an a- helix, B sheet, a reverse turn, etc.?) Explain why. "Note: Although you may use the DSSP algorithm (among others) to provide the prediction, you should still explain what features of the amino acid sequence make it more likely to be part of a type of secondary structure to receive full credit. 1: TNVVIKVC 2: SAIGKIQD 3: SETKCTLK 4: INLVRDLP 5: VLHSTQDL 6: KIADYNYK

Biochemistry

9th Edition

ISBN:9781319114671

Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Publisher:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.

Chapter1: Biochemistry: An Evolving Science

Section: Chapter Questions

Problem 1P

See similar textbooks

Similar questions

Describe an experiment in which you demonstrate that the pUL44 protein of Cytomegalovirus (CMV) localizes with phospho-H2AX (yH2AX). What reagent can be used to denote the cellular location of H2AX? Be sure to carefully describe your controls, as well as the expected results. What other technique can be used to validate the findings in this experiment? Explain.
1. Glycoproteins coat the outside of viruses; in particular they are important in helping HIV dock to our cells and also help the virus evade our immune system. Below is an image of the HIV transmembrane gp120 protein docking to human cd4 cells via the CXCR4 receptor. HIV-gp120 HIV CXCR4 Coreceptor CCR5 Coreceptor CD4 Receptor CD4 Cell a) i) Describe the general chemical interactions that might be involved in protein- protein interactions between the HIV gp120 protein and the human cd4 CXCR4 protein. Hypothesize what type of amino acid R groups you might find on the ii) exterior regions of each of these proteins, iii) and on the membrane bound portion of these proteins. b) The tertiary structure of gp120 is shown below. Please describe the protein (make sure to cover primary, secondary, and tertiary levels).
How were the structure of ACE2 and spike protein solved? describe the key processes involved in vaccine manufacturing. why is it easier to target a single mutant than a multiple mutants? why is SARS-CoV-2 so dangerous? summarise the key difference in the invasion of cell by: HIV, Adenovirus, Anthrax,SARS-CoV-2 and MERS What are the key players in the various mutants of spike proteins?
Several vaccines against viral infections are made by isolating purified surface proteins of the viral particle, mixing them with an adjuvant to stimulate an innate immune response, and injecting the mixture into people. Two examples of this are the vaccine against Hepatitis B virus, and the vaccine against Human Papilloma Virus (the ‘cervical cancer’ vaccine). One interesting property of vaccines of this type (known as ‘subunit vaccines’) is that there is a requirement for a CD4 T cell response to the vaccine antigen in order to generate antibodies to the innocuous protein in the vaccine. In the case of the Hepatitis B vaccine, the viral protein included in the vaccine is the Hepatitis B surface antigen (HepB-SAg), a protein that is approximately 200 amino acids in length. The graph in Figure Q4.27 shows the data from immunizing individuals with this vaccine, and monitoring their production of protective antibody responses to the viral protein. a) What results would be predicted if…
3) Would mRNA vaccines be as effective against bacteria as they are against viruses? Why or why not? Questions related to SARS-CoV-2 Inhibitor Science Article (Zhang et al.) 1) What is the function of the viral main protease? 2) What is the amino acid recognition sequence that is cleave by this main protease? Indicate where this protease cuts? 3) Would interfering with this protease effect other proteases in human cells? 4) How closely related are the amino acid sequences between SARS-CoV-2 and SARS-CoV? What does this suggest about focusing research on inhibiting this enzyme?
During the development process of a vaccine for the newly discovered Sars-COV-2 (COVID- 19) virus, pharmaceutical companies developed two potential vaccine candidates, BNT162b2 and Ad26.COV2. Some researchers postulated that BNT162b2 will be more ef- fective than Ad26.COV2 because only BNT162b2 directly targets the protein-manufactur- ing mechanisms in the cell. To test this claim, researchers proposed an experiment in which data will be collected about the efficacy of the two vaccine candidates. In the proposed study, two groups of mice will be randomly assigned one of the vaccine candidates and then infected with the virus. Data about the severity of symptoms in each group will then be collected. Which of the following describes a potential method for measuring the dependent variable in this experimental design? A B с D measure the amount of virus administered to each group measure the time between vaccine administration and virus infection in each group measure the amount of vaccine…
A cell is infected with an HIV mutant that results in very little virus being released into the medium that is used to grow the cultured cells. Upon electron microscopy it is noted that the membrane of the infected cell is idenitcal in appearance to a cell that has not been infected. In addition there is relatively little viral RNA in the cells and relatively few proviruses in the cellular genome when compared to a non-mutant HIV infection. Which of the following proteins is most likely mutated? Multiple Choice gag reverse transcriptase vif vpu
1. Precise words:Find the nonspecific terms in the following sentences. Replace the nonspecific choices with more preciseterms or phrases (It is not necessary to change the sentence structure).(i) All OVE mutants showed enhanced iP concentrations.(ii) Plants were kept in the cold overnight.(iii) To provide proof of concept for our hypothesis, we studied a virus in its host cell.(iv) The present paper reports on continuing experiments that were performed to clarify thissurprising effect.(v) The first transition state is a little lower in energy than the second transition state. 2. Simple words:Improve the word choice in the following examples by replacing the underlined terms or phrases withsimpler word choices (do not change the sentence structure).(i) These data substantiate our hypothesis.(ii) The difference in our results compared to those of Reuter et al. (1995) can be accounted forby the fact that different conditions were used.(iii) For the purpose of discussing cell migration we…
In the study of the SARS-CoV virus protein codes, it was discovered that eight potential open reading frames (ORFs) encode hypothetical SARS‐CoV‐specific proteins which lack obvious sequence similarity to known proteins. What possible function could these proteins have that would add to the infectious quality of the virus?
1. "One structural form used in building virus particles is based on the icosahedron. Describe, either in words or in a diagram, the organization (number of capsomers, etc.) of the simplest virus particle of this form. 2. If a virus has a negative‐sense RNA genome, what enzymatic activity (if any) will be found as part of the virion, and what will be the first step in expression of the viral genome?"
Given that BOVID-12 seems to have a significant affect on brain organoid size you decide to take iPSCs and differentiate them into neurons. The iPSCs mature into early neural progenitor cells (Early NPCs), then late neural progenitor cells (Late NPCs), and then neurons. You take each of these four cell types and infect them with the BOVID-12 virus. The results are shown below: Early NPCs Late NPCs Cell viability relative to mock infection iPSCs → IPS cells Neurons Late NPCs 120% 100%- 80%- 60%- 40%- 20%- 0%- 0.1 1 Amount of virus Which cell type(s) are unaffected by the virus? Both Early and Late NPCs wwwwwww.. iPSCs and Neurons Early NPCs Neurons 10
2. Does SARS-CoV-2 conform to the central dogma of molecular biology that was coined by Francis Crick? 3. Retroviruses, like the HIV, contain an enzyme called reverse transcriptase. Explain the flow of genetic information in HIV. 4. COVID-19 vaccines such as Moderna (MRNA-1273) and Pfizer (BNT16262) make use of mRNA that produces SARS-CoV-2 spike protein. Would the effectiveness of these vaccines be affected by the emerging SARS-CoV-2 variants with mutated spike protein?