1. It is observed that as temperature is increased, most protein molecules go from their defined, folded state into a random-coil, denatured state that exposes more hydrophobic surface area than is exposed in the folded state. (a) Given what you have learned so far about AH and AS, explain why this is reasonable. (b) Sometimes, however, proteins denature as temperature is decreased. How might this be explained?

1. It is observed that as temperature is increased, most protein molecules go from their defined, folded state into a random-coil, denatured state that exposes more hydrophobic surface area than is exposed in the folded state. (a) Given what you have learned so far about AH and AS, explain why this is reasonable. (b) Sometimes, however, proteins denature as temperature is decreased. How might this be explained?

Chemistry

10th Edition

ISBN:9781305957404

Author:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Publisher:Steven S. Zumdahl, Susan A. Zumdahl, Donald J. DeCoste

Chapter1: Chemical Foundations

Section: Chapter Questions

Problem 1RQ: Define and explain the differences between the following terms. a. law and theory b. theory and...

See similar textbooks

Similar questions

To the following statement, answer true or false and explain your answer. Q)To be meso, a molecule must have at least two chiral centers
Give detailed Solution with explanation (don't give Handwritten answer,,)
Write down the Structure Activity Relationship(SAR) of Tricyclic Antidepressant(TCA)
One of the free energy (G)-reaction coordinate graphs given below belong to a ligand-binding protein, while the other two belong to two different enzymes. A)Which of the given graphs cannot belong to an enzyme? A, B or C Choose one of the options and explain your reasoning in one or two sentences. B)What does it mean if an enzyme has reached catalytic perfection? means? Which of the graphs of free energy change given above Could it belong to a catalytically perfect enzyme? C)what kinetic parameter/combination of parameters an enzyme shows its efficiency / whether it has reached catalytic perfection? D)Which step in the Michaelis-Menten mechanism is the rate of diffusion? limited to?
Write the Structure Activity Relationship (SAR) of Losartan ? Please write at your own words.
Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1
The chemical structure of cysteine (C3H-NO₂S) is shown below. Highlight each atom that is in an amino group. :S H | HC-H H-C | H-N-H :0: || C. -0-H X 5 Save For Late
In relation to the spatial structure of the proteins select the INCORRECT alternative: (a) The quaternary structure of proteins consists of the association of two or more protein chains to form the complete protein. (b) The tertiary structure of proteins is mainly due to long-range interactions between amino acids that are far apart in the protein sequence but spatially close due to protein coiling. (c) Disulfide bridges are produced or broken as a result of oxidation-reduction processes. (d) The interactions between peptide chains in the secondary structure of proteins are basically due to Van der Waals forces. (e) The primary structure of proteins is basically due to the existence of covalent bonds between the different amino acids that constitute them.
Please answer the following question in the screenshot, thank you!
Explain the importance of the dielectric constant of water in stabilazing hydrophobic interaction amoung biomolecule
How many chiral centers does this molecule have?
Draw a chair that can be defined cis/trans. Explain why cis/trans is the appropriate description. Please do it neatly !! No cursive so I can understand