Ở Tuesday- Assignm xA Copy of Protein Syr xE Copy of Module 6Untitled: Oct 6, 202 xRapididentityBb Lincoin Courcs.google.com/document/d/1Q99JR3MU144ATP26_k5QDp7mzs87Ebac Jdavww.nz0/editProced.Launch Meeting - Z.Big Five Movie Star.O Identifying Coelfici.NI Washington Career. Accountability: Les..O Untitied preSynthesis Practicensert Format Tools Add-ons HelpLast edit was 48 minutes agoMerriweath..o田ロ- === =▼三▼Normal text11Protein SynthesisFor each of the following sequences, fill in the item that has been left blank: the DNA, the mRNAsequence, or the amino acid sequence. The mRNA codon chart is found on the 2nd page.1.DNAMRNAAUGACUAGCUGGGGGUAUUACUUUUAGAmino AcidTACCGCTCCGTCGCCGACAATACCACTDNA Asigrim xECopy of Protein Syr XFCopy of Moduie 6t X Untted Oct 6, 202 x apididentitycom/document/d/1Qq9jR3mU144ATp26 k5QDp7mzs87Ebac JdavwW.nz0/editLaunch Meeting-Z.Big Five Movie Star..I dentifying Coeffici.Washington Career..V Accountability: Les..sis Practice Ormat Tools Add-ons HelpLast edit was 49 minutes agoNormal textMerriweath..11BIU A2 I 35 II6DNAMRNAAUGACUAGCUGGGGGUAUUACUUUUAGAmino AcidDNATACCGCTCCGTCGCCGACAATACCACTMRNAAmino Acid3.DNAmRNAUACCACCCCCGUAUGGCUGGGAAUAUCAmino AcidM

Name: Ở Tuesday- Assignm xA Copy of Protein Syr xE Copy of Module 6Untitled
Uploaded: 2024-03-20T06:42:55.000Z
Channel: Bartleby
Description: Ở Tuesday- Assignm xA Copy of Protein Syr xE Copy of Module 6Untitled: Oct 6, 202 xRapididentityBb Lincoin Courcs.google.com/document/d/1Q99JR3MU144ATP26_k5QDp7mzs87Ebac Jdavww.nz0/editProced.Launch Meeting - Z.Big Five Movie Star.O Identifying Coel

CENTRAL DOGMA:- The whole process of Central Dogma involves two processes:- 1) When DNA changes into…

Answered: DNA MRNA AUG ACU AGC UGG GGG UAU UAC…

Science

Biology

DNA MRNA AUG ACU AGC UGG GGG UAU UAC UUU UAG Amino Acid DNA TAC CGC TCC GTC GCC GAC AAT АСС ACT mRNA Amino Acid DNA MRNA UAC CAC CCC CGU AUG GCU GGG AAU AUC Amino Acid

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter3: Biological Macromolecules

Section: Chapter Questions

Problem 17RQ: Mad cow disease is an infectious disease where one misfolded protein causes all other copies of the...

See similar textbooks

Similar questions

A Classwork for BTMF_Itani_ Biolo x A S'ERRA STANLEY -protein-synth X O 8 period light reaction - Google S x google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit - protein-synthesis-worksheet_practice-converted O sert Format Tools Add-ons Help TUR Last edit was 10 minutes ago 0% Normal text Noto Sans BIUA 川。三E▼=、三三 13 + 田回▼ 1 3 4. 5 8. DNA → TAC AGA CGG CAA CTC TGG GTG CTT TGT TCT CTT CTC AGT ATC mRNA → protein > Son out Co 4. 6. 8. 9.
light reaction - Google: Jod. google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit NLEY-protein-synthesis-worksheet_practice-converted @ w Insert Format Tools Add-ons Help Last edit was 7 minutes ago 100% - Normal text Noto Sans . BIUA 12 川, 三三▼ 3 5 Y 6. 7 I 3. DNA → TAC CTT GGG GAA TAT ACA CGC TGG CTT CGA TGA ATC CGT ACG GTA CTC GCC ATC MRNA → protein → 4. DNA → TAA ACT CGG TAC CTA GCT TAG ATC TAA TTA CCC ATC mRNA → protein → 5. DNA - CTA TTA CGA TAC TAG AGC GAA TAG AAA CTT ATC ATC MRNA → protein → Sign out 围 Ce & 6. 8. 3. de 5
E Classwork for BTMF_Itani_ Biolo X E SI'ERRA STANLEY - protein-synth X arch 8 period light reaction - Google S x ocs.google.com/document/d/1plhyciPrM-AMsQKmaUHZSZU44EJL85jDuCyDxE01E60/edit LEY-protein-synthesis-worksheet_practice-converted ☺ Insert Format Tools Add-ons Help Last edit was 5 minutes ago 100% Normal text Noto Sans . BIUA 12 川, 三= + - I 1. 2 . 4. 5 PART C. Use your codon chart to determine the amino acid sequence. Remember to read through the strand and ONLY start on AUG and STOP when it tells you to stop. Follow example below: Example: DNA O AGA CGG TAC CTC CGG TGG GTG CTT GTC TGT ATC CTT CTC AGT ATC mRNA O UCU GCC AUG GAG GCC ACC CÁC GAA CAG ACA UAG GAA GAG UCA UAG protein 0 start - glu – ala -thre - hist – asp -glu-threo-stop acid acid 1. DNA → CCT CTT TAC ACA CGG AGG GTA CGC TAT TCT ATG ATT ACA CGG TTG CGA TCC ATA ATC MRNA → protein → 2. DNA → AGA ACA TAA TAC CTC TTA ACA CTC TAA AGA CCA GCA CTC CGA TGA ACT GGA GCA MRNA → protein → 围 Sign out Co & 6. 7
AKS 5c1: Which of the following models BEST represents protein synthesis? * O MRNA (UAC AAA) - DNA (ATG TTT) Amino Acid Sequence (Lysine-Alanine) - Amino Acid Sequence (Methionine- DNA (TAC AAA) RNA (AUG UUU) Phenylalanine) RNA (AUG UUU) DNA (TAC Amino Acid Sequence (Methionine-Phenylalanine) AAA) DNA (AUG UUU) RNA (TAC AAA) Phenylalanine) - Amino Acid Sequence (Methionine- AKS 5c1: Using codon wheel below, which of the models correctly represents the usage of the base pairing rule, the correct sequence of events, and creation of proteins at the ribosomes? *
ty of Indianapolis : 20202 X ace.uindy.edu/portal/site/202020-BIOL-104-07/tool/2e4f1021-614d-4fae-83d6-ff99ca3767e0/jsf/delivery/beginTakingAssessment M Gmail YouTube Maps A ApneTV Home of H... What is the first step in protein synthesis? O A. making an RNA copy of the DNA within the nucleus B. making a sequence of amino acids O C. forming peptide bonds between amino acids OD. making a copy of RNA with DNA outside the nucleus Reset Selection
Drag the labels onto the diagram to identify the anatomical terminology describing body orientation and direction (human a Posterior (caudal) Distal Superior (dorsal) Proximal Inferior (caudal) Anterior (ventral) Posterior (dorsal) Pearson arch
Name: Date: 2. The sequence of a fragment of one strand of DNA is AATTGCATATACGGGAAATACGACCGG. Transcribe this s sequence into MRNA. er bns eldst eboo oi ebitqeqylog erlt to noihiog eri qu elsm bluow tsri abios onime Jlaw as ye s 1ot noitem atelomet AHG 3. The following MRNA ştrand is being used to asemble a polyp
Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA
Met – Asn – Cys – Phe – Glu – Met – Leu – Arg – Ile – Asp – Glu – Gly – Leu – Arg – Leu – Lys – Ile – Tyr – Lys – Asp mRNA sequence (5’-3’)AUG – AAC – UGU – UUU – GAA – AUG – CUU – CGU – AUU – GAU – GAA – GGU – CUU – CGU – CUU – AAA – AUU – UAU – AAA – GAU - Write the dsDNA that encodes for this peptide
B W S sult, it makes the protein Why is denaturing the proteins necessary for SDS PAGE to work? Use YOUR OWN X mand 3 E D с $ R F 5 Lê 6 T G MacBook Pro B Y H U N J 8 I M 9 K O I O L 44 P command . : 8 ; x { + C option ? I } 1 M
Direction: Study the given amino acid sequence and DNA sequence of the Amino Acid Sequence: LEU-ISC-PRO-PRO-PHE-ILE-LEU-LEU-SER-HIS-LEU-LEU-SER What's More Activity 3.1 Check and Relate listed organisms. Cat DNA Sequence: TTAATCCCCCCGTTTATCCTACTTTCCCATCTACTAAGT Am no Acid Sequence: LEU-ISC-PRO-PRO-PHE-ILE-LEU-EU-SER-ARG-LEU-LEU.AD DNA Sequence: CTTATCCCCCCGTTTATCCTACTTTCCCGTCTACTTCGT Shark Amino Acid Sequence: LEU-ISC-PRO-PRO-PHE-ILE-LEU-LEU-SER-HIS-VAL-VAL-SER DNA Sequence: CTAATCCCCCCGTTTATCCTACTTTCCCATGTAGTAAGT Colphin Amino Acid Sequence: LEU-ISO-PRO-PRO-PHE-LE-LEU-LEU-SER-ARG-LEU-LEU-ARG DNA Sequence: CTAATCCCCCCGTTTATCCTACTTTCCCGTCTACTTCGT Lizard Amino Add Sequence: ISO-4SO ASP-GLN-PHE-ILE-LEU-HIS-SER-ARG-LEU-LEU-ARG DNA Sequence: ATTATCGACCAGTTTATCCTACATTCCCGTCTACTTCGT Sponge Activity Questions: 1. Which organisms are closely related to each other? How are they related? 2. What does this tell us about the organisms and their ancestors? 3. How amino acid sequences and DNA…
Which amino acid sequence will form part of which protein structure, and why? Sequence 1: Ser-Phe-Gln-Val-Lys-Leu-His-Tyr-Asp-Val Sequence 2: Glu-Tyr-Leu-Asn-Phe-Ala-Gln-Val-Leu-Arg __Amphipathic beta strand __ Amphipathic alpha helix