Define these aspects of bioenergetics: couple reactions, allosteric enzymes, activation energy
Q: Draw the Ala-Ser-Leu-Asp polypeptide (perspective formula) showing the fully extended backbone…
A: Proteins are folded peptides. Peptides are polymers made up of amino acid residues linked via a…
Q: Classify each of the following fatty acids as saturated, monounsaturated, or polyunsaturated.…
A: • Saturated fatty acids: saturated fatty acids are fatty acids that contain only single covalent…
Q: 15. A hydrocodone bitartrate and acetaminophen oral solution contains 500 µg hydrocodone bitartrate…
A: In the given question we have to calculate the mass of hydrocodone bitartrate are needed to prepare…
Q: At which pH value does the amino group of amino acid have the best buffering capacity? 9.00 9.69…
A: The titration curve of a species give us the following information.Number of ionizing groups in the…
Q: 6. A quantitative amino acid analysis reveals that bovine serum albumin (BSA) contains 0.58%…
A: Amino acids, such as glycine, tryptophan, and alanine are organic molecules that contain an amino…
Q: Predict the products of this organic reaction: CHI O CHÍCH CCHCHI CHO 4 NaOH Ang Specifically, in…
A: When you mix a compound that has an ester in it with sodium hydroxide (NaOH), something interesting…
Q: Decide whether each of the following statements is true about ornithine carbamoyltransferase. It's a…
A: Ornithine carbamoyltransferase is an enzyme is important in the urea cycle. Urea cycle is a…
Q: What are the pathways used in the production of secondary metabolites present in flavonoids (Present…
A: Flavonoids belong to the class of secondary metabolites in plants. They have a poly phenolic…
Q: which of the following amino acids can undergo post-translational acetylation? A.n B.s C.k D.m
A: Acetylation is a type of reversible post translational modification of protein where an acetyl group…
Q: What is it about alpha helices and beta sheets that would make the coils less flexible?
A: The structure of proteins is a fascinating realm of biology and chemistry. Within the hierarchy of…
Q: Asp 102 His 57 -H-N [His] [His+] pH = pK₂ + log (AA [HA] = Ser 195 `N----H-O Identify the ways that…
A: Proteases are enzymes that cleave peptide bonds that link two amino acid residues together.…
Q: The results of a separation using two-dimension gel electrophoresis are shown here. Which protein or…
A: Two-dimensional gel electrophoresis is a technique used in proteomics studies.This technique is…
Q: Match each error with its consequence for protein purification by column chromatography. Incorrect…
A: Column chromatography is a separation technique that uses a stationary phase and a mobile phase to…
Q: What is the difference in atp formation in glycolysis and o inactive metabolism
A: Glycolysis is a metabolic pathway that occurs in the cytoplasm of cells. It breaks down one molecule…
Q: Below is a U-tube experiment with a membrane that is selectively permeable to water, but does not…
A: Here we are using a U-tube. The height of water column in both tubes are the same, so the force…
Q: A weak acid, HA, has a pK₁ of 4.756. If a solution of this acid has a pH of 4.101, what percentage…
A: To calculate the percentage of the weak acid HA that is not ionized in a solution with a given pH,…
Q: In each case, these are enzymes that catalyze thesame reaction in different species. The question…
A: 1.Aminopeptidases (PR1A from mammal and PR1B from malaria parasite):First, obtain the…
Q: The Michaelis-Menten equation models the hyperbolic relationship between [S] and the initial…
A: Protein-based biological entities called enzymes serve as accelerators in living things. They are…
Q: Suppose the molecule in the drawing area below were treated with Benedict's reagent. Edit the…
A: There are four types of biological macromolecules- proteins, nucleic acids, carbohydrates and…
Q: This is an image of double stranded DNA. Which red label in the above diagram is closest to the 5'…
A: DNA or the Deoxyribonucleic acids serves as the ge immaterial of almost all biological organisms…
Q: What is the net charge of cysteine in an aqueous solution at pH 9? Carboxyl group pKa = 1.92; Amino…
A: Cysteine is a polar but uncharged amino acid with thiol side group. The cysteine side group is…
Q: Explore the advancements in packaging technology, including aseptic packaging and vacuum packaging,…
A: By shielding food from physical, chemical, and microbiological harm, effective packaging is crucial…
Q: Consider an alpha-helix comprised of twelve amino acid residues. How many hydrogen bonds should be…
A: Proteins are linear polymers of amino acids which form the basic unit. Amino acids consist of a…
Q: A peptide has the sequence: Glu–His–Trp–Ser–Gly–Leu–Arg–Pro–Gly 1. What would be the net charge of…
A: The ionizable groups in a peptide include its N-terminal alpha-amino group, C-terminal…
Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…
A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…
Q: Write if TRUE/FALSE. mRNA splicing takes place in bacteria. In eukaryotes, replication and…
A: FALSE. Explanation:mRNA splicing does not take place in bacteria. mRNA splicing is a process that…
Q: Step 6 of the citric acid cycle is shown. Which statement best describes the role of FAD in this…
A: Citric acid cycle is a metabolic pathway that regenerates oxaloacetate from citrate. Acetyl CoA from…
Q: Are the given examples representative of acid-base catalysis, covalent catalysis, or metal ion…
A: Enzymes are proteinaceous entities that help the precedence of chemical reactions. The reactions…
Q: An enzyme catalyzes a reaction with a Km of 9.00 mM and a Vmax of 3.55 mM s¹. Calculate the reaction…
A: Applying the Michaelis-Menten equation, one may utilize the following formula to determine the…
Q: Concept map: construct a map of gas transport using the following terms. alveoli, arterial blood,…
A: Q.Ans:- These all terms belong to a single physiology known as Respiration.Respiration is a term…
Q: Creatinine, C4H7N3O, is a by-product of muscle metabolism, and creatinine levels in the body are…
A: Let's calculate the mass of creatinine in a 10.0 mL blood sample. The normal level of creatinine in…
Q: The hexokinase can be inhibited by a non competitive inhibitor. On your enzyme show where the non…
A: Hexokinase catalyzes the reaction of glucose binding to ATP to form glucose 6 phosphate. The…
Q: A peptide has the sequence Gly-Ser-Lys-Ala-Gly-Gly-Arg-Ser-Arg. How many fragments would result from…
A: Trypsin is a serine protease. It cleaves peptides at the C-terminal side of Lysine (Lys) and…
Q: Part B Calculate the nonequilibrium concentration of ethanol in yeast cells, if AG = -38.3 kJ/mol…
A: The free energy of a reaction is represented by ∆G. Under standard conditions, it is represented as…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Label the key components of a matrix-assisted laser desorption/ionization time-of-flight, or…
A: Matrix assisted laser desorption ionization-time of flight mass spectrometry (MALD1-TOF) is a…
Q: draw a gel with samples treated similarly with components below
A: Gel electrophoresis is a separation technique of charge molecules based on their size (molecular…
Q: Choose any/all that apply to mRNA processing in eukaryotes. The "starter/initiator" methionine codon…
A: The transcript that is produced as a result of transcription of an eukaryotic DNA sequence is called…
Q: Estimate the apparent slope of the plot for myoglobin. myoglobin apparent slope = Estimate the…
A: The Hill plot is the graph we obtain by plotting at X-axis and at Y-axis. By looking at the value…
Q: Assume that you have a solution of 0.1 M glucose 6-phosphate. To this solution, you add the enzyme…
A: Standards free energy change calculated at biochemical standards is called biochemical standard free…
Q: Determine the relationship between compounds 1 and 2 Is it A - meso compounds b - enantiomers C-…
A: Stereoisomers are the isomers in which molecular formula are same for both the isomers but they…
Q: Substance X is transported by passive transport and Substance Y is transported by active transport…
A: Membrane transport refers to the movement of solute substances across or through a membranous…
Q: Which of the following amino acids or types of amino acids is rarely found in beta sheets? Polar…
A: Beta sheets are a common secondary structure in proteins, characterized by a sheet-like arrangement…
Q: In lab 4, you calculated cholesterol levels of a sample directly based on the absorbance ratio of…
A: In laboratory experiments involving the quantification of cholesterol levels, precise and reliable…
Q: Which of the following define the stereochemistry of alanine (as per the structure shown)? Note:…
A: stereochemistry can be defined as the arrangement of functional groups on the alpha carbon atom with…
Q: Consider the sterilization of a sodium gluconate production medium in the holding section of a…
A: Answer :- Sterilization is a critical process in various industries, including food and…
Q: Match the THE BEST DESCRIPTION with the proper enzyme. RNA Polymerase I RNA Polymerase II RNA…
A: The central dogma of molecular biology is a theory that describes the flow of genetic information in…
Q: Phosphoglucoisomerase interconverts glucose 6-phosphate to, and from, glucose 1-phosphate.…
A: Details
Q: Proteins have a variety of roles. Which role is shared with elaborately folded RNA? Being structural…
A: Proteins are biomolecules that serve diverse functional roles within a cell. Proteins that catalyse…
Q: Draw the amino acids serine and threomine bonded together with a petide bond.
A: Amino acid
Step by step
Solved in 5 steps
- Discuss how enzymes make life possible from a biochemical perspective. Include activation energy barrier,rate of reaction,metabolic regulation, substrate specificity and spontainity of reactionExplain the uses of some biotechnologically produced enzymes in industry.Differentiate competitive and noncompetitive inhibitors of enzymes
- Discuss several ways in which metabolic pathways are controlled or regulated.Discuss the role of enzymes in metabolic regulation by describing the following five mechanisms.11.1Cascade systems11.2 Futile cycle11.3Cellular compartmentalization 11.4 Covalent modification11.5 Zymogens. To catalyze a biochemical reaction, an enzyme typically dissociates into additional reactant molecules, thereby increasing the геaction ratе decomposes and releases energy to increase the number of successful collisions between reactant molecules binds temporarily to reactant molecules to lower the activation energy of the reaction drives the reaction to completion by consuming byproducts of the reaction CLEAR ALL
- which factors influence the choice of bioreactor design?Classify the following into either activation processes or inhibitions processes. Process Phosphorylation of a transport protein (i.e. pump) The binding of a substrate molecule at the active site of an enzyme The binding of a molecule at the active site of an enzyme, but in place of the substrate The allosteric binding of ATP to the phosphofructokinase (an enzyme part of glycolysis)What are the biological actions of enzymes ? What reactions do they catalyze? please include citation