1. You have a circular plasmid (PUC57), which consists of 2710 bp. What would the number and length of the fragments be if you cut the plasmid with the following restriction enzymes or a combination of enzymes?. Show all calculations. a. Pdml & Gsul b. Ndel. Sapl & BseYI c. Scal, Sspl & Ehel
Q: How does the iron–sulfur world hypothesis differ from the prebiotic soup hypothesis? What do these…
A: The creation of heritable and upgradeable self-reproduction is the origin of life. The "Origin of…
Q: When determining the purity of DNA, it understood that pure DNA is identified by a ratio of between…
A: When isolating nucleic acids from a cell, the final product is a mixture of DNA, RNA and Proteins.…
Q: fluid balancing maintain fluid homeostasis
A: The lymphatic system helps maintain fluid balance in the body by collecting excess fluid and…
Q: The ability for mothers to hear their baby's cry, but not other, louder sounds is best explained by…
A: For the human baby before birth, the term fetus is used. The term infant is applied to very young…
Q: 13.Which region of the leaves is the location to which most of the photosynthesis takes place?Read…
A: Photosynthesis is the process by which plants use sunlight, water and carbon dioxide to create…
Q: Compare and contrast the three main types of exploitativespecies interactions. How do predation,…
A: The population of different species present in a community interacts with each other and with…
Q: Which tissue delivers dissolved sugar throughout the plant?Read and analyze the question and choices…
A: Plant tissue is a grouping of similar cells that collaborate to perform an organised purpose for the…
Q: As a genetic counselor, you inform Susan and John that a blood test for cystic fibrosis is…
A: Genetic counselor
Q: Where do regulatory transcription factors bind relative to a gene sequence?
A: Transcription factors are proteins that affect the rate of gene transcription by binding to…
Q: Even though a very few cells in a C4 plant carry out the biosynthetic - Calvin pathway, yet they are…
A: C4 pathway is also known as Hatch - slack pathway which is a photosynthetic process of carbon…
Q: In your point of view as a senior high school stem student, is it important that we should be…
A: Health is a state of whole bodily, intellectual, and social well-being and no longer simply the…
Q: Which of the following dephosphorylates PI 3,4,5-trisphosphate, thereby blocking the activation of…
A: The survival and growth is promoted by the PI3K-Akt signaling pathway. Protein Kinase B and…
Q: 6.Which term refers to the waxy or fatty layer of most epidermal cells that forms a protective layer…
A: Epidermis is the outer covering layer of the cells that forms the covering of the root, stem, leaf,…
Q: Question 3 What are the diseases associated with hypocomplementaemia and which complement deficiency…
A: Health epidemiology
Q: In Central America, it has been found that if natural forests are retained within and around coffee…
A: Win-Win situation It is a kind of situation when all parties are benefitted or are satisfied in some…
Q: Question 8. What method can be used to compare the transcriptomes of individual single cells?
A: Methods used for comparing the single cells transcriptomes.
Q: What would allow two cells from the same individual to respond differently to an environmental…
A: Cell communication It refers to the way a cell receives, understands, and sends signals to its…
Q: Table 1: Characteristics of DNA Questions To what maior group of biomolecules does DNA belong? wers…
A: INTRODUCTION DNA Deoxyribonucleic acid is the heriditary material present in humans and other…
Q: There are two variants of the enhancer sequence found in people. One has the sequence CACTAAAG, and…
A: Regulatory sequences or elements are the DNA sequences that serve as a binding site for regulatory…
Q: In the amplicon insert you have an enzyme restriction site for NdeI at 500 bp. If you digest the…
A: Restriction enzymes These are also known as molecular scissors. These are enzymes that have been…
Q: 3. a. In the process of converting ADP to ATP, water is circle one: (REQUIRED / RELEASED) and…
A: Adenosine diphosphate(ADP) Important organic compounds in metabolism and is essential to the flow of…
Q: Describe how a morphogen acts in development.
A: Morphogen in development :-
Q: what is the function of Sodium dichlorophenolindophenol with relation to vitamin c?
A: Vitamin c is made up of a chemical called ascorbic acid with the C6H8O6 as the molecular formula.…
Q: Which plant cell have unevenly thickened cell walls which provide flexible support for the growing…
A: The peripheral part of the cortex frequently contains collenchyma. Collenchyma is a supporting…
Q: Which of the following interventions will increase cardiac stroke volume? increased activity of…
A: Stroke volume: The quantity of blood discharged from the ventricle during each cardiac cycle is…
Q: If you were attempting to tell whether an animal produces itsprimary urine by ultrafiltration or…
A: Ammonotelic animals are those that have the tendency to produce ammonia. Ammonia is considered their…
Q: One of the main objectives of BI308 is to learn to think scientifically about animal behaviour. I…
A: Human behavioral ecology (HBE) is the study of human behavior from an adaptive perspective. It…
Q: species’ population dynamics
A: Population Dynamics is related to ecology ( study of living organisms with relation to…
Q: Being as specific as possible, discuss how global warming can beexpected to alter the water…
A: The release of greenhouse gases in the air has caused an increase in the global temperature called…
Q: What is the vascular bundle arrangement of a monocot plant? Read and analyze the question and…
A: Monocot stems have scattered vascular bundles. Dicot stems have their vascular bundles in a ring…
Q: 29. In the pedigree below, squares represent males and circles represent females. Individuals who…
A: Pedrigee analysis is the representation of presence of particular traits and how they are inherited…
Q: 1. Recombinant DNA technology products are now used in various fields, some in agriculture, while…
A: Recombinant DNA technology It refers to the combining of DNA molecules from two distinct species.…
Q: 3.Which hormone promotes ripening of fruits? Read and analyze the question and choices CAREFULLY;…
A: Ripening in fleshy fruits induces changes such as coloure development, softening, starch hydrolysis,…
Q: Draw a simple sketch illustrating the way in which aerobic bacteria are hypothesized to have become…
A: The origins of multicellularity and its complexities are still being debated in evolutionary…
Q: Diagram and describe how mispairing and crossing over between two different split genes could result…
A:
Q: (i) Why does Neostigmine cause an increase in the twitch tension when the nerve is stimulated and…
A: Health epidemiology
Q: The first cells were probably (a) photosynthetic (b) aerobes (c) anaerobes (d) a and b (e) a and c
A: The first photosynthetic bacteria appeared about 2 billion years ago and they are able to produce…
Q: Why is not any one parameter good enough to demonstrate growth throughout the life of a flowering…
A: There are a number of plant varieties along with the tissues and the cell has a tendency to grow at…
Q: List TWO (2) differences between smooth muscle contraction and skeletal muscle contraction.
A:
Q: Austria and Luxembourg banned the import of genetically modified cotton seeds by Monsanto as they…
A: Genetic pollution or genetic contamination is the unintentional introduction of genetically…
Q: .... Several set of terms are used to indicate the direction and position when describing the…
A: Some standard anatomical terms of location are used to describe the anatomy of animals including…
Q: Question 4. Why is a single-stranded, circular DNA an ineffective template for DNA polymerase?
A: Introduction Single-stranded DNA is a DNA molecule that has only one nucleotide strand while…
Q: is DNA replication called semiconservative? A. Both daughter strands are entirely new B. Each…
A: Replication of DNA is very important for the transmission of chromosomal DNA from one generation to…
Q: During the Early _______________, life consisted of prokaryotic cells, but by the end of this…
A: The major evolution evens since the origin of the earth have been categorized into three major eras.
Q: How does the sequence of the primary transcript resemble the sequence of the gene encoding it?…
A: The primary mRNA transcript is practical as soon as it's far synthesized. This is visible when…
Q: 2,It is mentioned that although streptomycetes contain many molecules with antimicrobial activity,…
A: * Streptomycetes belongs to the genus Actinomycetota and family Streptomycetaceae. *Over 500…
Q: Define oxygen dissociation curve. Can you suggest any reason for its sigmoidal pattern?
A: Oxyhaemoglobin saturation curves are graphs that show the percentage saturation of oxyhaemoglobin at…
Q: Please help me im so confused. a. Which is the homogametic sex in humans? ii. the heterogametic…
A: Homogametic The partner which form all gametes having same sex chromosomes.
Q: The first step leading to allopatric speciation is (a) hybrid inviability(b) hybrid breakdown (c)…
A: Speciations are the process in which species evolve into something so drastically different than…
Q: Why are food chains relatively short? O Not enough energy is transferred from one trophic level to…
A: Food chain is defined as the series of organisms on which one organism feeds on below level…
Bacterial Genomics
The study of the morphological, physiological, and evolutionary aspects of the bacterial genome is referred to as bacterial genomics. This subdisciplinary field aids in understanding how genes are assembled into genomes. Further, bacterial or microbial genomics has helped researchers in understanding the pathogenicity of bacteria and other microbes.
Transformation Experiment in Bacteria
In the discovery of genetic material, the experiment conducted by Frederick Griffith on Streptococcus pneumonia proved to be a stepping stone.
Plasmids and Vectors
The DNA molecule that exists in a circular shape and is smaller in size which is capable of its replication is called Plasmids. In other words, it is called extra-chromosomal plasmid DNA. Vectors are the molecule which is capable of carrying genetic material which can be transferred into another cell and further carry out replication and expression. Plasmids can act as vectors.
Trending now
This is a popular solution!
Step by step
Solved in 2 steps with 2 images
- ersonal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc={a6b083c9-a226-4c31... ☆ Search (Option + Q) Review View Help Picture Editing A В ... During nucleic acid hybridization, the probe is labelled Question 1 options: for DNA stability to increase probe-test DNA binding to identify the location of probe and the test DNA binding for amplification Question 2 6. 9. 10 IV 13 14 Which of the following best describes the trait in the pedigree? Question 2 options: X-linked dominant X-linked recessive autosomal domiant autosomal recessive ONNumbering the fragments left by cutting the DNA with BAM HI from left to right, which fragment will travel the furthest? BAM HI: GGATCC CCTAGG AATCGGATCCATTTGGACTAAAGGACCCGGATTGGATCCAGGGCCTTTAGTACC TTAGCCTAGGTAAACCTGATTTCCTGGGCCTAACCTAGGTCCCGGAAATCATGG O 3 O 2 4. 1.Ao三 Normal No Spacing Hea A- = = =国位。|鱼 三、 、■ Styles Paragraph Section B: Circular DNA [12] Eco01091 2698 Pfol 46 BstAPI 179 Aatil 2641 Sspl 2525 Ndel 183 Ehel 235 Pdml 2318 396 MCS lacz lac. 146 2510 Bcgl 2239 Scal 2201 236 476 493 PUC57 2710 bp BsaX 683 Sapl 707 2/6 Afll, Psel 830 Gsul 1808, Cfr101 1803. Eco311 1790. Eam11051 1718 1650 1400 rep (PMB1) BseYl 1134 Cail 1241 CAFT TR Lad l The d Mat The M 1. You have a circular plasmid (pUC57) which consisrs of 2710 bo. What would the number and length of the fragments be if you cut the plasmid wih the following essibility: Investigate 52 OO C a bla (Ap) EGO
- a) what si the nucleotide at the 5 prime end of the picture? b) what si the DNA sequence from 5 prime to 3 prime pls help, urgently required, no explanation neededTable I CACGT A GA CTGAGG ACTC CACGTAGACTGAG G ACAC Wild-type beta-globin gene fragment Sickle-cell beta-globin gene fragment > Circle the mutation in DNA of the sickle-cell beta-globin gene fragment Compare fragments of DNA the wild-type and mutant beta-globin genes in the Table I above, what are the similarities and differences you observe?11:29 Protein 6-10092015113530.pdf https:api.schoology.comv1attachment169963838... Name Class Date 2. How are enzymes involved in this process? 3. hаppens anzips"? 4. Why is it important that exact copies of DNA be made? 5. Suppose that a sequence of one DNA strand is T-A-C-A-A-C-G-T-G. What is the corresponding sequence on the other strand? E Concept Mapping The construction of and theory behind concept mapping are discussed on pages vil-ix in the front of this Study Guide. Read those pages carefully. Then consider the concepts presented in Section 7-1 and how you would organize them into a concept i page 74. Notice that the concept map has been started for you. Add the key Now look at the concept map for Chapter 7 on concepts you are important Secti When you have finished the chapter, you will have a completed concept map. 69 1 of 1
- Aa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT Write the amino acid sequence of the protein that would be formed by translating this plece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids, Use the abbrevlation of the amino adid exactly as Itswritten in the table (including the appropriate capltalizations For example it your answer for amino acid 1 is"Methionine" you would write MET in the box (not Met or met) Second Later UUU UUUC Phe UCU UAU Ser UAC UAA UAG Tyr UGU Cys U Leu UCA ucG UGC Stop uGA Beop UUG Step UGG Trp G Cuu C cuC CUA CUG CU Leu Coc CCA CG CAU Pro cGu CAC CAA CAG His CGC Arg CGA CGG 1st 3rd letter AUU A AUG AUA AUG ACU le AAU AAC AGU ACC Asn Ser U leBer ACC ACA Mct ACG The AAA AAG ACA Lys AGG Arg acu Val GCC GCA GCG GAU GAC GAA GAG GOU GGC GGA GGG Arp G GUC GUA GUG Ala Gly Glu Seovence of the protein, 1st amino acid. 2nd arnino acid: 3rd amino acid: 4th amino acid Sth amino acid: 6th amino acid: 7th amino…A Meet - rfc-prp x A G-Unit 5: DNA an X 4 https://docs.goog x y google classroom xP Classes cs.google.com/forms/d/e/1FAlpQLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHN0OdqFX_aDbV_6-bKw/formResponse x New Tab D YouTube Маps E Copy of Distance Le. Launch Meeting - . 2020 HORNETS 4N. O StudentVUE 2 Mr. Nussbaum Lan. A Graphing Lines Use the chart to determine the correct amino acid that this DNA would code for - ATA * 1 point GFL E D А Y STOP Alanine U Tyrosine C. STOP Stop V Valine GU Cysteine U Stop G Tryplophan R Arginine G А С U A Leucine S. K Serine A C L UGA Lysine Proline Аsparagine M START H. I R o search 99. Serine Threonine
- 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…Genetic Code-Reference Second Letter First Letter C Third Letter UAU] UACS **UAA Stop UGU] Cys UGC U UUU Phe UUC UCU Туг UCC U Ser UUA) Leu UUG **UGA Stop UGG Trp UCA UCG **UAG Stop CUU CCU CAU) CGU His CACJ CAA) CUC CCC CGC Leu Pro Arg CUA ССА CGA A Gln CUG CCG CAGJ CGG AAU] AGUSer U AUU ACU AACAsn AAA Lys AUC Ile ACC AGC C Thr AGA] Arg AUA ACА AAGJLYS GAU] GACASP *AUG Met/Start ACG AGG U GUU GCU GGU Asp GUC GCC GGC Val Ala Gly GAA) Glu GAGJ GUA GCA GGA GUG GCG GGGMutated DNA Sequence #3 T A C A C C T T A G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ Mutated DNA Sequence #4 T A C A C C T T G G C G A C T A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ______________________________