Part A Mark the location of each antibiotic's action by dragging the labels onto the diagram of a ribosome below. Tetracycline Erythromycin Kasugamycin Thiostrepton Streptomycin Chloramphenicol Submit Request Answer 3 GDP AUGJUCGGU LAC T!!!! AAGUGA AAG +EF-Tu GTP 3' Reset Help
Q: QUESTION 10 The sarcoplasmic reticulum stores ions of: chloride calcium O sodium O potassium
A: The question spins around the function of the sarcoplasmic reticulum in muscle cells. The…
Q: A rare recessive trait, when exhibited in men, is transmitted to half of their daughters and none of…
A: Genetic disorders are caused due to variants, or mutations in a single gene. These disorders are…
Q: When intracellular concentrations phosphofructokinase to be ( Main Content ats) to be OA) low, low…
A: Aerobic respiration is the process of cellular respiration in which various respiratory substrates…
Q: 1. Epithelial tissues are classified according to the shape of the cells and number of the cell…
A: Animal tissue known as epithelial tissue creates glands, lines cavities, as well as covers the…
Q: A common soil fungal species is suddenly detected as an aggressive wheat pathogen, decimating crops…
A: Fungi are a group of microorganisms that belong to the kingdom Fungi. They are eukaryotic organisms,…
Q: What results on a microdilution antimicrobial susceptibility test would indicate an antibiotic would…
A: An antimicrobial susceptibility test is a scientific procedure used to evaluate how effective…
Q: https://www.youtube.com/watch?v=FVuNTiqHys0 Do you think that animals like Koko who has the…
A: The hypothesis proposes that all species of life forms emerge and create through the natural…
Q: dominance hierarchy territorial behavior courtship ritual: altruism agonistic behavior Example…
A: Courtship rituals are a series of behaviors and displays exhibited by animals during the mating or…
Q: See image
A: The sequences are:AACGATGCCATCAGAGCCCAGGACGTGATTTAATTGCTACGGTAGTCTCGGGTCCTGCACTAAATT
Q: Describe the process of transpiration in detail. How does water move from the roots to the leaves of…
A: Transpiration is a physiological phenomenon in which water is conveyed from the plant's roots to its…
Q: The most important reward circuit in the brain is the mesolimbic pathway. Dopaminergic neurons…
A: The mesolimbic pathway is a critical neural circuit in the brain associated with the experience of…
Q: 1. For each question, use allele symbols and text to explain your answer. A. Is it possible for a…
A: The blood group depends on the presence of specific antigens on the membrane of RBCs and red blood…
Q: Impulsiveness: A) has been linked to functional and structural changes in the brains of drug…
A: Impulsivity is a complex trait that is influenced by a variety of factors, including genetics, brain…
Q: Cells are inherently dynamic systems characterized by multiple, low-affinity interactions between…
A: Answer :- In biology , the term "stasis" is of particular significance. It represents a fundamental…
Q: DNA Typing U S₁ S₂ Locus 1 U S₁ S₂ U S₁ S₂ Locus 1 Locus 2 U S₁ S₂ U S₁ S₂ Locus 2 Locus 3 1. In…
A: A forensic method referred to as DNA typing, commonly referred to as DNA profiling or DNA…
Q: In mammals, there are two sex chromosomes, X and Y, which behave like homologous chromosomes during…
A: To give rise to an XYY male, there must be an extra Y chromosome in the offspring's genetic makeup…
Q: Which of the following is an advantage of asexual reproduction? (choose all correct answers)…
A: Asexual reproduction is a type of reproduction in which an organism gives rise to offspring having a…
Q: Nucleosomes aggregate and disaggregate a.through the attachment of ubiquitin. b.through the…
A: Nucleosomes are fundamental units of chromatin structure, consisting of DNA wrapped around histone…
Q: Phalaropes are shore birds with brightly colored females and dull colored males. Females are larger…
A: Sexual dimorphism is described and defined as the differences in size, looks, appearance, or…
Q: bacterial replication fork
A: This is the site within a bacterial DNA molecule where the replication of DNA occurs actively.This…
Q: Label the anatomical parts of the root and shoot system of a plant. Place your cursor on the labels…
A: The study of the tissue and cellular makeup of plant organs is known as plant anatomy. When…
Q: I have a large number for my standard deviation. What does this tell me about the variability in my…
A: Standard deviation is the deviation of the given set of data from it's mean value. In statistical…
Q: 2. Robert Koch was a German physician who identified the bacteria causing anthrax and tuberculosis.…
A: "Since you have posted multiple questions with multiple sub parts, we will provide the solution only…
Q: Why is there an upper limit on how large cells can become? Large cells have a small volume…
A: Cell is the basic structural and functional unit of life. A cell is defined as the aqueous…
Q: Label the diagram: 3'4 5' Primer 5' 15' '3'
A: The heterocatalytic processes by which a new DNA strand is synthesized on a old DNA template is…
Q: Which of the following primers could extend this piece of single stranded DNA in a PCR reaction?…
A: In molecular biology and genetic research, the Polymerase Chain Reaction (PCR) is a fundamental…
Q: Which of the following statements about lipids in membranes is FALSE? O Membrane curvature may be…
A: Lipids are pivotal components of cell membranes, impacting membrane structure and function.…
Q: Which of the types of energy is NOT one a part of energy transformation chain during respiration and…
A: Several cellular organisms with chlorophyll employ the biological procedure of photosynthesis and…
Q: Name and describe 5 properties of cancerous or tumor cells from patients(in vivo) and of cancerous…
A: Cancerous cells are abnormal cells that grow uncontrollably, invade surrounding tissues, and can…
Q: el Which of the following is a comma-shaped, Gram-negative bacterium that acts as a predator on…
A: Bacteria are relatively simple, microscopic and prokaryotic organisms which lack nucleus and other…
Q: Which of the following levels of organization is arranged in the correct sequence from most to least…
A: Ecosystem: An ecosystem is a broader concept that encompasses both living (biotic) and non-living…
Q: O Increased ADH and increased aldosterone secretion O Increased ADH and decreased aldosterone…
A: ADH is also known as Vasopressin. It plays a crucial role in regulating water balance in the body.
Q: Consider the pedigree of a family with an autosomal recessive disorder. Analyze the pedigree to…
A: Understanding genetic inheritance patterns is crucial in assessing the risk of individuals carrying…
Q: Observe the diagram below and answer the following questions: Image Source: Wikimedia Commons…
A: Mitosis and meiosis are the two distinct processes of cell division. When we talk about "cell…
Q: What behaviors during the egg-laying season might lead to potential behavioral adaptations that…
A: characters During the breeding season,the following behaviors can lead to behavioral changes that…
Q: What are functions of the M7G cap? Select all the apply. Slows degradation from the 5' end of the…
A: The process by which mRNA is produced from DNA is called transcription and the process by which…
Q: It is possible to treat addiction by prescribing drugs that block the effects of the psychoactive…
A: Agonists are the drugs which attach to the receptor generating an identical response to the…
Q: Consider a gram negative pathogen isolated from marine mammals. This pathogen is subjected to a…
A: Here in this question we are given certain characteristics and on the basis of it we have to…
Q: Peripheral membrane proteins may noncovalently interact with phospholipid heads O contain many…
A: Peripheral membrane proteins display distinct features:Potential Noncovalent Interaction with…
Q: In Drosophila,, the curled mutation (cu, chromosome 3, position 50.0) results in wings that curl up,…
A: Alleles are the alternative forms of a gene that are located on the same locus of a homologous…
Q: One example of non-Mendelian inheritance is uniparental inheritance. Choose the definition of…
A: Non-Mendelian genetics refers to inheritance patterns that do not follow the simple Mendelian…
Q: Create a visual representation, or a diagram, of the concepts in respiration and photosynthesis. You…
A: Photosynthesis: The process by which green plants produce oxygen and energy in the form of sugar in…
Q: Fill in the blanks: One example of transepithelial transport is the system in intestinal epithelial…
A: The plasma membrane or the cell membrane is the external layer that acts as a selective barrier…
Q: Polyethylene glycol (PEG)-conjugated IFNs have superior pharmaceutical properties compared with…
A: Polyethylene glycol (PEG)PEG, short for polyethylene glycol, is a type of substance that is good at…
Q: Cross Section of Earthworm
A: Earthworm is a terrestrial invertebrate organism that is found in soil. The phylum of earthworm is…
Q: TERMS BOX Endothermic Exothermic Catabolic Terms that describe this reaction Spontaneous Terms that…
A: Living organisms show metabolic activities in their cells that are responsible for maintaining the…
Q: QUESTION 2 Most sensory stimuli are interpreted in: 00 the cerebrum sensory receptor cells O…
A: Actin is a crucial protein found in cells, particularly in muscle cells. It plays a fundamental role…
Q: A group of individuals that can interbreed in nature and produce viable offspring would be…
A: A species is a group of living beings that can interbreed or share certain characteristics. A…
Q: f you breed fast box turtles and use midparent-midoffspring regression to determine that the…
A: In the world of breeding and genetics, the idea of heritability performs a critical position in…
Q: phenotypic ratio
A: Phenotypic Ratio: The phenotypic ratio is a representation of the observable physical…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps with 1 images
- Enzyme Carboxypeptidase A CBZ-NH-CH, C-NH-CH-COOH CH₂ C6H5 Papain a-chymotrypsin Substrate HIV protease N-CBZ-glycyl-L-phenylalanine ก CBZ-NHCH--C--NH-CH, CẢNH CH2 CH₂ N-CBZ-L-phenylalanyl-glycyl- p-nitroanilide CHỦ NHCH I CH2 CH --NH-CH-C-NH--CH,-COOH N-acetyl-L-phenylalanyl-glycine NH on C.NH NO₂ CH3 CH₂ CH2 C6H5 -NH-CH--COOH 1 CH3 N-acetyl-L-valyl-L-phenylalanyl-L-alanine Inhibitor I i CBZ-NH-CH -C--NH-CH-COOH 3Z--NH-CH I CH 3 CH2 C Hs N-CBZ-D-alanyl-L-phenylalanine CBZ--NH-CH--C--NH--CH, I CH₂ C6H5 N-CBZ-L-phenylalanyl-glycinal CH3-C-NH-CH-C-OH CH₂ C6H5 N-acetyl-L-phenylalanine CH3 quemq CH₂-CH-COOH -NH-CH-C-CH2-CH-COOH CH2 CH3 CH3 CH3 C6H5 --NH-- N-(N-(acetyl)-valyl)-5-amino-5-benzyl-4-keto- 2-methyl-pentanoic acid Inhibitor II CBZ-NH-CH₂--P--NH--CH--COOH 0 N-(CBZ-aminomethyl-oxyhydroxyphos- phinyl)-L-phenylalanine 1 CH2 C6H5 CBZ--NH-CH--C--NH-CH2-COOH I CH 2 C6H5 i N-CBZ-L-phenylalanyl-glycine CH3--C--NH--CH--CH(OH)CH₂CH2COOH CH2 C6H5 N-acetyl-5-amino-5-benzyl-4-hydroxy-…For any antibiotic compounds that don’t appear to inhibit translation of proteins from the ribosome, purpose another potential mechanism whereby this class of antibiotic might be able to act (outside of cell wall/membrane formation). Explain in deatil.How is the ribosome a target in terms of antibiotic action mechanisms? https://www.youtube.com/watch?v=IVBCrzjOl40
- >hypothetical protein [Comamonadaceae bacterium CR] MSLKERIQEEMKAAMRAKDTARLGAIRLLLAAIKQKEVDERVMLDDAAIIAVVDKLIKQRRDSVTAYQQA QRSDLADKEAAEITVLEAYLPQRWSRAEVEEAVSRVVAETAATGPGDMGKVMAAVKAQCQGKADMAVVSQ VVKAALAARGG Using the Lehninger scale, what is the charge of this protein at pH 4.0, pH 7.0, and pH 9.0?Most medically useful antibiotics interfere with either peptidogly¬can synthesis or ribosome function. Why would the cytoplasmic membrane be a poor target for antibacterial medications?Most medically useful antibiotics interfere with either peptidoglycan synthesis or ribosome function. Why would the cytoplasmic membrane (in general) be a poor target for antibacterial medications?
- Most medically useful antibiotics interfere with either peptidoglycan synthesis or ribosome function. Why would the cell membrane be a poor target for antimicrobial medication?Translation initiation efficiency can be regulated by which of the following: The affinity of the tRNAS for their cognate tRNA synthetases O The affinity of the ribosome binding site on the MRNA for the 235 rRNA in the 50S subunit O The affinity of the ribosome binding site on the MRNA for the 16S rRNA in the 30S subunit O The affinity with which the 50s and 305 subunits bind to each otherMatch the antibiotic to its target with bacteria. erythromycin [ Choose ] [Choose ] streptomycin, an aminoglycoside bacterial enzymes involved in folic acid synthesis Bacterial gyrase tetracycline bacterial transpeptidase 70S ribosomes Bacterial RNA polymerase ampicillin Bactrim= trimethoprim + sulfa drug [ Choose ] rifampin [Choose ] ciprofloxacin, a fluoroquinolone [ Choose ] >
- b. Cleavage with chymotrypsin produces the following fragments: Band A: CN , NLQY, GIVEQCCHKRSEY Band B: F, Y, DPTKM, IACCVRGF, RTTGHLCGKDLVNALY Cleavage with Staphilococcus aureus V8 protease produces the following fragments: Band A: GIVE, YNLQNYCN, QCCHKRCSE Band B: PTKM, RTTGHLCGKD, LVNALYIACGVRGFFYD What is the amino acid sequence of the protein? Type your responseUse the following statements that best describes the antibiotic mechanism for each: Statement: Targets cell wall synthesis Targets protein synthesis Targets nucleic acid synthesis Targets cell membrane Inhibits folic acid synthesis (metabolism inhibitor) Pseudomaona aeroguinosa Plate Antibiotic Amoxicillin Cephalothin Chloramphenicol Ciprofloxicin Clindamycin Erythromycin Oxacillin Penicillin G S. aureus Other Streptomycin Tetracycline Tobramycin Trimethoprim sulfaUse the following statements that best describes the antibiotic mechanism for each: Statement: Targets cell wall synthesis Targets protein synthesis Targets nucleic acid synthesis Targets cell membrane Inhibits folic acid synthesis (metabolism inhibitor) E. coli plate antibiotic: Amoxicillin Cephalothin Chloramphenicol Ciprofloxicin Clindamycin Erythromycin Oxacillin Penicillin G S. aureus Other Streptomycin Tetracycline Tobramycin Trimethoprim sulfa