Which of the following biomolecules is/are NOT amphipathic?
Q: Each of the amino acid residues in the catalytic triad is part of what polypeptide chain?
A: The enzymes carry out the catalysis of various reactions in metabolism. The catalytic triad helps…
Q: The diversity of functional groups on sugars that can form glycosidic bonds greatly increases the…
A: Amino acids are the organic acids that contain alpha carboxyl group, alpha amino group, hydrogen…
Q: Chymotrypsin is a pH dependent protein. Enzymatic activity is the greatest between pH=7.0 to pH=8.5.…
A: Chymotrypsin is a protease that is secreted by the pancreas. It cleaves the peptide bond next to the…
Q: Write schematically the synthesis of phosphatidylethanolamine through the activation of amino…
A: INTRODUCTION : Phospholipids : They are a group of biochemical compounds which are made up of fatty…
Q: (a) Draw an example of a triglyceride molecule and name the functional group that links the glycerol…
A: Note: Since you have posted multiple independent questions in the same request, we will solve the…
Q: The predominant forms of actin inside a cell are ATP–G-actin and ADP–F-actin. Explain how the…
A: these are cytoskeletal membrane protein
Q: Combustion of glucose (C6H12O6) is the main source of energy for animal cells: -> + C6H12O6s 602g +…
A: Molecular weight of glucose is 180.156 g150 mg glucose is equivalent to (0.15/180.156) mol =…
Q: Saccharide X, a sugar composed of repeating cellobiose and maltose, is a constituent of two…
A: Glycoproteins are consisted of protein and glycan moiety which is involved in several biological…
Q: Saccharide X, a sugar composed of repeating cellobiose and maltose, is a constituent of a…
A: Plants constitute a large number of carbohydrates. Glycobiology means the study of the…
Q: Saccharide M, a sugar made of repeating units of maltose and cellobiose, is a component of…
A: Glycoproteins are consisted of protein and glycan moiety which is involved in several biological…
Q: You are studying a catalytic protein which contains two ion clusters, one cluster contains 2 Cu+3…
A: Proteins are the biomolecules that are building blocks of the body. Proteins are made up of amino…
Q: Which of the following is the polyadenylation signal sequence? AAAAAA O AAUAAA O AAAUAA AAUUAA
A: Polyadenylation signal sequence :- is the signal sequence needed to add poly A tail at 3' end of…
Q: Which of the following amino acid types is mostly likely to be hydroxylated in a posttranslation…
A: Hydroxylation is defined as a process of oxidation reaction where the carbon-hydrogen bond in the…
Q: What is the most consistently (i.e. found in every case) energetically unfavorable aspect of protein…
A: People have developed molecular dynamics simulations of the basic atomic forces that determine a…
Q: Acetylating agents such as acetic anhydride react preferentially with primaryamines, iodoacetate…
A: Acetic anhydride or ethanoic anhydride, is the chemical compound. It is the simplest isolable…
Q: Explain how G protein enzymatic activity and signaling activity relates to guanine nucleotides.
A: G proteins, otherwise called guanine nucleotide-restricting proteins, are a group of proteins that…
Q: Here is a putative peptide sequence (position number on top of residues): 1 2 3 4 5 6 7 8 9 10 11…
A: Hi! Thanks for your question. As you have posted multiple sub-parts, we are answering only the first…
Q: The death cap mushroom (Amanita phalloides) is considered one of the world’s deadliest mushrooms.…
A: Amatoxins, the class of toxins found in some mushrooms, are thermostable: which resist changes due…
Q: Review the amphipathic structure of sphingomyelin. Which components are hydrophilic, and which are…
A: The lipid molecules that possess both polar (hydrophilic) and non-polar (hydrophobic) ends are known…
Q: Consider, for example, that a particular serine residue is phosphorylated to activate the protein.…
A: Phosphorylation can either activate or deactivate a protein. Phosphomimetics replaces amino acids in…
Q: What roles do allosteric regulation and feedback inhibition play in themetabolism of a cell?
A: The functioning of cells is wrapped around the chemical reactions which they can carry out. The rate…
Q: When specific conditions are met, the creation of peptide bonds rather than the hydrolysis of…
A: Proteins are unbranched polymers constructed from 20 standard α-amino acids. They have four levels…
Q: It is important for a protease to distinguish between two different proteins so that it only cleaves…
A: The building blocks of proteins are organic substances called amino acids. They have a side chain (R…
Q: Synthesis of peptide bonds is [exorgonic or endergonic]. Thus in isolation, this reaction would…
A: Protein synthesis takes place in the ribosome. It required the hydrolysis of GTP. The translation is…
Q: Consider a mutation that results in a substitution of Cysteine (CYS) ) for Tyrosine (TYR) at…
A: Cysteine is a polar amino acid. Cysteine is a triprotic acid with three ionizable functional…
Q: One single polypeptide chain (120 amino acid residues) is produced for protein A in prokaryotic…
A: A polypeptide chain is a linear or cyclic compounds which have amino acids as the building units of…
Q: Consider a hexapeptide of the sequence thr asn glu trp lys gln. After complete hydrolysis, which…
A: Asked : Amino acid which elutes first
Q: Many eukaryotic enzymes, such as fatty acid synthase, are multifunctional proteins with multiple…
A: multifunctional enzymes are those enzymes in which there are two or more active sites.
Q: Is a protein as good a cellular buffer at physiological pH as its constituent amino acids would be…
A: Since we only answer 1 question in case of multiple question, we’ll answer the first question as the…
Q: Some proteins may be phosphorylated by enzymes called kinases. Which of the following statements…
A: While, other options are incorrect:"Phosphorylation is an irreversible modification of an amino acid…
Q: The helix, Tyr-Arg-Glu-Leu-Val-Asp-Ala-Ile-Leu-Arg-Glu-Val-Phe-Thr-Lys-Arg-Gly, is present in the…
A: Voltage gated sodium channels are present in neuron membrane .They open when there is enough voltage…
Q: Which of the following organisms incorporates peptides along with carbohydrates in its cell wall…
A: Cell wall is a protective layer outside the cell which protect cell stresses. It is the outer…
Q: rotein after a post-trans o other changes in the o
A: There will be more conjugate base because it makes a favorable hydrogen bond to the phosphate .
Q: Erk and P-Erk live in two different locations within the cell even though they are just two…
A: * Mitogen activated protein kinase also called as MAPK and p42MAPK, and ERK2 * It is an enzyme…
Q: Soap, phospholipids and cholesterol are all amphipathic molecules. Provide a drawing of each and…
A: Amphipathic molecules are chemical compounds containing both polar and nonpolar portions in their…
Q: Throughout the polypeptide chain, must the amino acid residues at the active site be next to one…
A: A polypeptide chain is a lengthy sequence of amino acids that contains amino acid residues that…
Q: S-adenosylmethionine is an activated carrier molecule that transfers which of the following groups?…
A: Activated carrier molecules are the molecules which breakdown into two molecules to release the…
Q: RNA molecules are more reactive than DNA molecules. Explain.
A: DNA is a deoxyribonucleotide which was a double-stranded molecule that has a long chain nucleotide…
Q: Propose an experimental strategy to characterize the sequence and linkages of different glycan…
A: Glycans are chain of carbohydrates/sugar molecules (like galactose, mannose, fucose, N-acetyl…
Q: Please depict a noncovalent interaction important for the function of lysozyme
A: The enzyme lysozyme aid in the breaking down of polysaccharides in the bacterial cell membrane. They…
Q: The amide hydrogen atoms of peptide bonds within proteins can exchange with protons in a solvent. In…
A: Hydrogen-deuterium exchange (HDX) is a technique that can be used to study the structure and…
Which of the following
Step by step
Solved in 2 steps with 1 images
- What is the importance of pyrophosphatasein the synthesis of nucleic acids?Although STATINs are the first line therapy for the treatment of hyperlipidemia, sometimes it fails to control the lipid in some patients. Explain and discuss the reasons for which statins may not be able to control the hyperlipidemia. What would be the alternatives treatment approach in those patients? Explain the rationale for such use.Bovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?
- Certain enzymes catalyze the covalent linkage of an acetyl group to lysine amino acids as shown below. When a particular target protein is in the un-acetylated state, its interacting partner protein will not bind. However, once acetylated, the partner protein can bind to this target protein. Which of the following can you conclude? Select all that apply CH CO NH 3. NH Lysine acetylation reaction CH, CH, +HaN -C- CO- H. HIN-C- Co- H. UAcetylation changes the secondary structure of the target protein The partner protein has acidic residues in the interacting region Acetylation changes the tertiary structure of the target protein The partner protein has basic residues in the interacting region 8-1-8-8-8–8–d=Describe the process by which a fatty acid such aspalmitate (a C16 straight-chain saturated fatty acid) issynthesized in a cell.An engineered ligand binds its target with 5 nM affinity at high pH. However, protonation of a histidine residue in the binding site of the ligand renders it unable to bind. Plot the ligand:target complex concentration versus the initial ligand concentration (in protonated or unprotonated form) at pH 4, 5, 6, 7, or 8 (five lines on one plot). Use a total target concentration of 10 nM.
- The molecule that condensed with a phosphate group to form the head group of the lipid shown in the first image (picture 6) is choline, an essential component of many cellular molecules. (a) Draw the structure of choline and explain why it needs a transport protein in order to enter cells. (b) Cells must transport choline from outside the cell (where it is relatively rare) to the inside of the cell (where it is relatively abundant). The diagram below represents a cell with a choline transporter (labeled T). Draw a solid arrow through the transporter to show the direction in which choline travels (into or out of the cell). (c) Is T an active or passive transport protein for choline? (d) For every choline molecule that moves through T, a sodium ion moves through the same transport protein at the same time. The sodium ion moves down its gradient. Add a dashed arrow to the diagram in part (b) to show the direction of movement of sodium. (e)…Imagine that a mutation has been discovered in the HBA1 gene, where amino acid residue # 1 in the alpha subunit is changed from valine to lysine. The structure of these two amino acids is shown below. How would this mutation affect the mobility of HbA in the gel?a) HbA with this mutation would have the same mobility as normal HbAb) HbA with this mutation would have the same mobility as HbSc) HbA with this mutation would have a faster mobility than normal HbA O d) HbA with this mutation would have a mobility somewhere in between HbS and normal HbASmall molecules are used as inhibitors of protein action - as drugs. They most often do this by blocking the active site within the protein. Potential drugs can be screened computationally to determine if they are strongly bound to the protein. Figure 1 shows a possible conformation of a candidate drug molecule, 4-bromo-2- carboxymethylamide-pyrrole (abbreviation: BCMAP) at the active site of a protein (abbreviation: PR). Figure 2 shows the full protein structure whilst figure 3 shows a known inhibitor of the protein at the site, overlayed with another calculated conformer of BCMAP. (a) Explain what types of interactions, both intermolecular and intramolecular, that a molecular mechanics forcefield must be able to describe in order to be able to accurately determine the geometry of BCMAP in the protein. Identify which interactions will be the most important to describe accurately. Figure 1.4-bromo-2-carboxymethylamide-pyrrole (BCMAP) (C, N, O, and Br atoms in yellow, blue, red, and…
- Saccharide X, a sugar composed of repeating cellobiose and maltose, is a constituent of two glycoproteins, which are receptors that are found in a certain membrane. For the first glycoprotein, the saccharide is linked by a(1-2) linkages to three sialic acid residues, then O-linked to the glycoprotein. The other glycoprotein, on the other hand, has the saccharide linked by a B(1-3) bond also to three sialic acid residues, then also O-linked to the glycoprotein. The saccharide was cleaved from its sialic acid residues. The treatments and results are as follows: 1. hydrolysis by B(1-> 4) - disaccharide products 2. hydrolysis by a(1-> 4) - release of 2 disaccharide & 2 monosaccharide units. Show the structure of the saccharide.Consider, for example, that a particular serine residue is phosphorylated to activate the protein. In the lab, a similar effect is achieved by mutating this residue to either a D (aspartic acid) or E (glutamic acid). What could be the reason?Can you please describe the specific components that each of these structures are comprised of ( alpha helices and beta sheets) in more detail? Also, what do the different colors represent? Your reply will be greatly appreciated. The ligand that was assigned to me is tadalafil.
