
Biochemistry
9th Edition
ISBN: 9781319114671
Author: Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher: W. H. Freeman
expand_more
expand_more
format_list_bulleted
Concept explainers
Question

Transcribed Image Text:The mutated form of hemoglobin (hemoglobin S, or HbS) in sickle-cell anemia results from the replacement of a glutamate residue by a valine residue at position
6 in the B chain of the protein. Normal hemoglobin is designated HbA.

Transcribed Image Text:Which amino acids would be expected to produce a similar sickling effect if substituted for Val at position 6?
leucine
O A.
O B. lysine
Oc. arginine
O D.
aspartic acid
DE.
isoleucine
Expert Solution

This question has been solved!
Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.
This is a popular solution
Trending nowThis is a popular solution!
Step by stepSolved in 2 steps

Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.Similar questions
- a. Identify the type of mutation shown below. b. How many amino acids are affected? c. What type of impact will this mutation have on the functionality of the protein? Second Letter UUU UUC UUA JUG UCu uCC UCA UCG UAU UAC UGU UOC Phe Tyr Cys Ser UAA Stop UGA Stop UAG Stop UGG Trp Leu cu cc Pro CUU COU CAU His CAC CUC CUA Leu Arg CCA Cca CGA CUG CAA Cin CAG AGU AGC AGA Arg AAU AUU AUC le AUA AUG Met ACO ACU ACC ACA Asn Ser AAC The MA AAG Lys AGG CAL KAC GUU Aep GUC Val CUA OCC Ala OCA GA Clu GAG Oly GOA GUG GGG Original DNA strand G AC 1. G. G. Mutated DNA strand GA Third letterarrow_forwardcomplete the sentence In the Sanger method, the nitrogen from the tripeptide (give the name of the tri-peptide using the one-letter-codes of the 3 amino acids forming it, no spaces or punctuation between letters. eg. ABC) (. ) shown above acts as a ( )arrow_forwardUCAGUCAGUOPODOTO E GFL A Alanine GU STOP Tyrosine A Stop C STOP V A Valine GU Cysteine G Stop G Tryplophan Arginine G A C A U Leucine Serine A UG Lysine Proline Asparagine GACUGACU H. MIR START Glycine Serine Leucine Glutamic Phenyl acid Aspartie acid Histidine RSK Glutamine Arginine Methionine Isoleucine Threoninearrow_forward
- You are in the process of determining theamino acid sequence of a peptide. After trypsin digestion followedby the Edman degradation, you see the following peptide fragments:arrow_forwardBovine insulin is composed of two polypeptide chains that are linked together covalently. The two chains have the following sequences: GIVEQCCASVCSLYQLENYCN - A chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA - B chain a. Through which amino acids are these two chains linked together covalently? b. How many different ways can these two chains be linked? c. Of the different connectivities you enumerated in part b, which is the biologically active form?arrow_forwardWhich of these mutations would you predict to be most detrimental? Explain your answer. (Refer to a chart of amino acid structures as necessary.) Asp to Glu Asn to Glu Cys to Lys Pro to Gly Val to Thrarrow_forward
arrow_back_ios
arrow_forward_ios
Recommended textbooks for you
- BiochemistryBiochemistryISBN:9781319114671Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.Publisher:W. H. FreemanLehninger Principles of BiochemistryBiochemistryISBN:9781464126116Author:David L. Nelson, Michael M. CoxPublisher:W. H. FreemanFundamentals of Biochemistry: Life at the Molecul...BiochemistryISBN:9781118918401Author:Donald Voet, Judith G. Voet, Charlotte W. PrattPublisher:WILEY
- BiochemistryBiochemistryISBN:9781305961135Author:Mary K. Campbell, Shawn O. Farrell, Owen M. McDougalPublisher:Cengage LearningBiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage LearningFundamentals of General, Organic, and Biological ...BiochemistryISBN:9780134015187Author:John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. PetersonPublisher:PEARSON

Biochemistry
Biochemistry
ISBN:9781319114671
Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher:W. H. Freeman

Lehninger Principles of Biochemistry
Biochemistry
ISBN:9781464126116
Author:David L. Nelson, Michael M. Cox
Publisher:W. H. Freeman

Fundamentals of Biochemistry: Life at the Molecul...
Biochemistry
ISBN:9781118918401
Author:Donald Voet, Judith G. Voet, Charlotte W. Pratt
Publisher:WILEY

Biochemistry
Biochemistry
ISBN:9781305961135
Author:Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Publisher:Cengage Learning

Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning

Fundamentals of General, Organic, and Biological ...
Biochemistry
ISBN:9780134015187
Author:John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. Peterson
Publisher:PEARSON