What mass in grams of dextrose and sodium chloride are required to prepare 250 mL of D10 NS electrolyte?
Q: Which of the following allow for the transport of protons into the mitochondrial matrix? a) Pyruvate…
A: Transmembrane proteins are a class of proteins that pass the entire length of the lipid bilayer.…
Q: 1) Find the pH of 0.1 M of the differnet forms histidine species. (See image for equation and pKa…
A: Amino acids are building blocks of the proteins. Alpha carbon of amino acids consist of carboxyl…
Q: A Class Il aminoacyl-tRNA synthetase installs the formyl-methionine on tRNAMet in bacteria. A…
A: As per the central dogma of molecular biology, genetic information is stored in the DNA. The genetic…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Draw the structures of reactants and products in the transamination in which glutamate and pyruvate…
A: In a transamination reaction, an amino group is transferred from a donor substrate to an acceptor…
Q: Multiple choice correct answer and explain every point 2. The factors that contribute to the…
A: Rate of reaction is speed of any chemical or biochemical reaction at which product is formed or…
Q: No MIC interpretive standards are given for penicillin G against E. coli. Which ONE of the following…
A: Penicillin G is a beta-lactam antibiotic that is used in the treatment of bacterial infections…
Q: C.Why does 500 mM imidazole result in the elution of a protein with a 6X-His tag?
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Iodoacetate reacts irreversibly with the free -SH groups of cysteine residues in proteins. List…
A: Calvin-Benson-Bassham cycle is commonly known as the Calvin cycle or Dark reactions of…
Q: What happens to the double helix when the bases pair in non complementary ways, for example a G-T…
A: As per the Watson-Crick model of the DNA double helix: DNA is made up of two strands of…
Q: Which of the following is true of the molecule below?
A: DNA/RNA are nucleic acids, the molecules responsible for carrying genetic information from one…
Q: The difference between purine and pyrimidine systhesis is: One builds the base on top of the sugar…
A: Among the nucleotides, adenine and guanine are purines. Cytosine and thymine are pyrimidines.…
Q: How many ATP will be yielded in 2 moles of an 17:0 and 18:0 carbon chain?
A: Beta oxidation is a process of oxidation of fatty acids into acetyl CoA. The total amount of ATP…
Q: An equilibrium dialysis study was carried out with a ligand binding receptor protein. The protein…
A: Scatchard plot is a very useful plot to determine the affinity of association of ligand and a…
Q: Vasopressin is a hormone that plays an important role in social behavior, sexual motivation, and…
A: Recall that: Amino acid sequences are written with N-terminal amino acid on the left and…
Q: Which of the following statements are true for enzymes? Check all that apply. The activity of some…
A: Enzymes are high molecular weight proteins (exceptions are catalytic RNAs) that catalyse biochemical…
Q: Draw the electron pushing mechanism
A: Electron pushing mechanism shows the jumping of electrons in the substrate and reaction…
Q: Hydrophobic interactions associated with protein tertiary structure involves: Acidic and basic…
A: During hydrophobic interaction, the non-polar molecules come together and interact with each other.…
Q: -11- E + SF k_1 ES ₂ E + P k2 › 10.0 + S ↓↑K IS ESS st Based on this model, please answer the…
A: The cessation of enzymatic activity is generally known as enzyme inhibition. It is generally of two…
Q: d. What type of inhibition is exhibited against NAD* as a cofactor? Describe what is going on in…
A: Any parameter of enzyme catalyzed reaction such as Vmax and Km can be obtained from Lineweaver Bur…
Q: A lab scale gel chromatography column packed with Superdex 200 is used to separate two antibodies A…
A: The total volume of a column is given by Vt=V0+Vi , Where V0 is the void volume and Vi is the…
Q: Aerobic glycolysis can produce ATP at a much faster rate than anaerobic oxidative phosphorylation.…
A: Pyruvate has a distinct outcome in anaerobic environments. Pyruvate is changed into lactate by the…
Q: The term protein is generally used for polypeptide with 40 or greater amino acid residues 100 or…
A: Proteins are composed of amino acids and each amino acid are linked via peptide bond to form peptide…
Q: What test tube will show positive starch hydrolysis and negative starch hydrolysis?
A: Starch is the most common carbohydrates (polysaccharides) which is a polymer of several glucose…
Q: Q9.2: Based on the premise of the thrifty gene hypothesis, predict if the following hypothetical…
A: The thrifty gene hypothesis suggests that certain populations carry thirfty genes that determine…
Q: The primary purpose of the aconitase step in Citric Acid Cycle is to: form the intermediate…
A: The citric acid cycle involves acetyl-CoA oxidation into carbon dioxide and water. The acetyl-CoA…
Q: calculate the [PNP] in μM for each of these samples.
A: Molarity is way of representing the concentration of a solution. Molarity is number of moles of…
Q: The disease phenylketonuria is characterized by increased nervousness and fidgeting. elevated levels…
A: Amino acids can be degraded & certain amino acid can be interconverted to another amino acid…
Q: Explain the regulation of biochemical pathways. Describe the regulation of β-oxidation. Describe the…
A: Beta oxidation is the catabolic pathway of degradation of fatty acids to release energy. Urea cycle…
Q: If glucose labeled with 14C in C-1 is metabolized to ethanol and CO2 via fermentation, which carbon…
A: Pyruvate is the end product of glycolysis. Under anaerobic conditions it can have two possible…
Q: The substitution of His 64 of carbonic anhydrase II with Ala results in a sharp decrease in the…
A: Carbonic anhydrase II is the enzyme that catalyzes the formation of H2CO3 from CO2 and H2O, and…
Q: Use the sequence provided here to identify the tag and tag location for the encoded DHFR fusion…
A: DHFR fusion protein: The enzyme known as dihydrofolate reductase, or DHFR, reduces dihydrofolate to…
Q: Classify each metabolic reaction as an oxidation-reduction reaction, isomerization reaction, or…
A: Metabolism is the total of all chemical transformation that takes place in a living cell. One…
Q: skimmed milk pasteurized milk evaporated milk condensed milk fortified milk…
A: Milk is a biological respiratory fuel synthesized by the mammary glands of mammals to nourish their…
Q: Explain biochemical pathways mechanistically. Describe the β-oxidation pathway. Describe the…
A: Lipids are stored in the form of triacylglycerols in the body. When there are no carbohydrates in…
Q: Upon doing the experiment of Protein Denaturation, what could be observed in the precipitation of…
A: Proteins are composed of chain of amino acids linked by peptide/amide bond which forms the primary…
Q: (a) Estimate the Km and Vmax for the wild-type and mutant enzyme from the graph. (b) Calculate the…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Please answer the following two questions: 1. Biochemistry and function of chylomicrons 2. The…
A: Chylomicrons are lipoproteins synthesized in the intestine. Lipoproteins are compound lipids…
Q: The patient has mechanical jaundice. Will it affect the absorption of fat-soluble vitamins? There…
A: To live a healthy and active life, humans need a variety of nutrients. Good nutrition, or the…
Q: Draw the substrate and product of each of enzymes below. Make sure to label. a) Phosphopentose…
A: Enzymes are biocatalysts that increases the rate of reactions that take place within life forms.…
Q: describe the functions of the pentose phosphate pathway. Explain how NADPH functions in biosynthesis…
A: In a cell, glucose 6-phosphate has two possible fates: be oxidised into carbon dioxide and water by…
Q: What is the main advantage of fluorescence polarization? Sensitivity of fluorescent probes Low cost…
A: FP is an analytical technique which provides information on orientation and mobility of…
Q: Cytochrome a is a component of: Complex I Complex II Complex III Complex IV
A: Introduction Electron transport chain consists of series of protein complex that transfers electrons…
Q: Mechanism of action of electron transport inhibitors. Amital.
A: INTRODUCTION : First of all, there is no electron transport inhibitor called Amital, it is a wrong…
Q: When an enzyme interacts with the substrate, which of the following occurs?
A: Enzymes are high molecular-weight proteins that catalyse biochemical reactions. They are also called…
Q: You are studying the DNA binding protein CLAMP and you want to determine its binding affinity for…
A: Introducion Transcription is a process by which mRNA is produced from DNA and protein is produced…
Q: a) You evaluate the lipoxygenase inhibition by different concentrations of octyl protocathechuate.…
A: Inhibitors are the substances that bind to enzymes to regulate their activity . There are…
Q: Graph a double reciprocal plot that satisfy the following: a. Michaelis-Menten kinetics enzyme,…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Which of the following describes the interaction between the amino acid last eluted and the anion…
A: In Ion exchange chromatography the molecules are separated according to their charge. The matrix…
Q: Below is a Michaelis-Menten plot for a wild-type (WT) and mutant (V105A) enzyme isolated from the…
A: The best way to find out the Vmax and Km values are by plotting the Lineweaver Burk Plot (LB Plot).…
What mass in grams of dextrose and sodium chloride are required to prepare 250 mL of D10 NS electrolyte?
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- How many grams of HCl are needed to make 10 uL of a 0.005g/mL acid solution?If 400 mL of a 20% w/v solution were diluted to 2 L, what would be the finalpercentage strength?What would be the working stock concentration (in molarity) if you diluted 250 uL of a stock concentration of 10 uM in a total volume of 1 mL?
- A 35 mL of solution of hydrochloric acid is neutralized by 15 mL of 0.5 M potassium hydroxide. What is the concentration of hydrochloric acid? The balanced equation is HCI + KOH - H,O + KCI O 0.75 M O 0.25 M O 0.214 M O 0.786 MHow many grams is one mole of potassium chloride KCI?439 mL of 0.270 M hydrochloric acid is exactly neutralized with 0.920 M potassium hydroxide solution. What volume of base solution is required?
- A 1–fluid ounce (29.573 mL) solution contains 4.5 grains (291.60 mg) of silver nitrate. How much sodium nitrate must be added to this solution to make it isotonic with nasal fluid?A 510 mL IV bag contains a 25% dextrose solution. How much of the original solution must be replaced with a 65% dextrose solution to increase the original concentration to 35%?Benzalkonium chloride 17% w/v . . . . . qs Water qs . . . . . . . . . . . . . . . . . . . . . . 120 mL M. ft . solution such that 2 tbsp added to a pint of water will yield a 1:750 solution. How many milliliters of the 17% w/v stock solution will be needed to prepare the 120 mL? a 2.68 mL b 7.90 mL c 15.80 mL d 20.40 mL e 6.28 mL
- In order to make a solution of the concentration 0.364 M, what mass of NaCl should bedissolved in 152 mL of water?12 grams of glucose will make how many mL of a 0.5 g/mL solution?If skin cleaning solution is to be diluted 1 teaspoon to 64 ounces of water, how much water would need to be added to a container containing 1/4 teaspoon of skin cleaning solution?