Part a) Would a single alpha helix be more stable in a aqueous solution or a membrane. Explain why. Part b) Why do transmembrane proteins always have secondary structures inside the membrane but aqueous proteins do not? Part c) If you had a single alpha helix, can it act as a pore for a membrane. Explain.
Q: Match the letters on the diagram below to the correct terms. 1. Glycoprotein E 2. Hydrophilic…
A: Introduction: Cell membrane is the outer covering of all cell but in plant cells, it is present…
Q: Define the term transmembrane proteins?
A: Membrane proteins are usual proteins that interact with cell membranes. These proteins fall into…
Q: All the following is a function of membrane proteins EXCEPT:
A: We are answering first question Pl repost for second question
Q: Why will you reconstitute the receptor into a lipid bilayer?
A: G-protein coupled receptor - It is also termed as 7 pass transmembrane domain receptor. this get…
Q: Define lipid bilayer
A: Lipids are the major constituent of the plasma membrane. These are composed of fatty acids and…
Q: According to the fluid mosaic model of cell membranes, which of the following is a true statement…
A: Cell membrane / plasma membrane is the membrane present on the outer side of cell that basically…
Q: Describe the lipid bilayer structure of a cell membrane. What are the roles of proteins in membrane…
A: Plasma membrane is the outer boundary of the cell. It is selective permeable in nature that is it…
Q: Why does presence of cholesterol enhance the membrane fluidity?
A: Introduction - There is multiple factors that result in membrane Fluidity. First, the mosaic…
Q: Which of the following is true about phospholipid bilayers? a. The hydrophobic head faces the cell…
A: The phospholipid bilayer consists of two layers of phospholipids, with a hydrophobic, or…
Q: In what way do proteins embedded in a membrane differ structurally from soluble proteins?
A: Proteins which can be embedded withinside the membrane are known as integral or intrinsic proteins.…
Q: Why don’t proteins turn around in biological membraneslike revolving doors?
A: Membranes : It is the thin layer that forms the outer boundary of a living cell or of an internal…
Q: Identify the three different types of membrane proteins.
A: The primary unit of life is the cell. Based on the number of cells an organism may be unicellular or…
Q: Can water cross plasma membrane easily? Explain?
A: Cell membranes organize and protect the cell. All cells have an outer plasma membrane and it…
Q: Which of the following correctly describes the structure of the phospholipid bilayer in plasma…
A: The plasma membrane is mostly made of phospholipids, which are fatty acids and alcohol. The…
Q: Although both faces of a biomembrane are composed of the same general types of macromolecules,…
A: The cell membrane is a double layer of lipids and proteins that surrounds a cell. It separates the…
Q: Why do they do not penetrate through the lipid bilayer?
A: The cell is the basic structural and functional unit of our body. It carries out many functions in…
Q: Why would a bilayer containing only gangliosides be unstable
A: The cell membrane can be defined as a biological membrane that separates the interior of all cells…
Q: Transmembrane portrudes on both sides. Integral protein is in the width of the bilayer and may…
A: An integral membrane protein is a type of membrane protein that remains permanently attached to the…
Q: the properties of lipids responsible for the property of bilayers?
A: Note - we answer one question at a time. The plasma membrane is also known as the cell membrane.…
Q: What is the phospholipid bilayer made of?
A: The plasma membrane is a microscopic biological membrane, made up of lipids and proteins that…
Q: Would substances be able to pass through the plasma membrane if the phospholipid tails of the plasma…
A: Transport of molecules become difficult across plasma membrane if the phospholipid tails of plasma…
Q: Which characteristic of a phospholipid contributes to the fluidity of the membrane?
A:
Q: what purpose does the plasma membrane’s hydrophobic interior serve?
A: Introduction The plasma membrane, also known as the cell membrane, is the membrane found in all…
Q: phospholipids regulate the flow of hydrophilic molecules? How does the bilayer layer regulate the…
A: PLASMA MEMBRANE:- It is also known as cell membrane or cytoplasmic membrane and this structure is…
Q: plasma membrane?
A: Nucleotides Carry Chemical Energy in Cells Nucleotides are joined together by covalent bonds…
Q: About this figure of a transmembarne protein; one of the following is false? Thickness of nembrane o…
A: The proteins are made up of polypeptide chains of amino acids that can form several structural…
Q: What drives the movement of lipid molecules and proteins within the bilayer? How can such movement…
A: The cell membrane is an important part of a cell as it determines the structure and function of the…
Q: Why should triacylglycerol be insignificant component of plasma membrane ?
A: Answer: Introduction: Plasma membrane are selectively permeable in nature and important cell…
Q: For a protein to be an integral membrane protein, it would have to be amphipathic, which means that…
A: Answer: Integral membrane proteins are the proteins which are embedded in phospholipid bilayer where…
Q: Which of the following statements is true of membrane proteins? a) They are suspended on the…
A: Introduction: Membrane proteins, as the name suggests, are proteins that either interacts with the…
Q: What are the functional significance of the fluidity of a cell membrane?
A: Cell membrane is also known as plasma membrane or cytoplasmic membrane. It is a biological membrane…
Q: comprise the membrane. If you isolated a single transmembrane helix from a protein from this strain,…
A: Since the newly identified bacteria has normal nucleic acids and proteins - the amino acids in the…
Q: Integral proteins are also known as Select one: a. Intrinsic proteins b. Glycosylated proteins c.…
A:
Q: What could happen to the proteins of cells treated with high amounts of free radicals that would…
A: The free radicals, such as superoxide anion (O2-) and hydroxyl radical (OH ), as well as the…
Q: Why is the lipid bilayer of a c
A: The cell membrane is the shape-maintaining component of the cell. It is present in both animal and…
Q: Why water cannot readily cross the plasma membrane?
A: Plasma membrane show fluid properties, i.e. Can show motion.
Q: How many layers of phospholipids make up the plasma membrane?
A: The plasma membrane, which is known as the cell membrane, is the membrane found in all cells that…
Q: Proteins, like lipids, are free to move in the membrane. How do we know this?
A: Membranes are composed of lipid bilayers.
Q: What is an example of a phospholipid bilayer?
A: a phospholipid bilayer is a unit membrane made of 2 layers of phospholipids in such a way that the…
Q: Draw the basic structure of a lipid bilayer and label thehydrophilic and hydrophobic regions. Why is…
A: Cell membranes or biomembranes are quasifluid, elastic, pliable, and film-like thin partition over…
Q: How do we know that membrane phospholipids regularly intermingle and move laterally, but rarely flip…
A: The cell membrane is also known as a cytoplasmic membrane or plasma membrane or plasmalemma.…
Q: Why are membranes more permeable to nonpolar molecules than to most polar and ionized molecules?
A: The cells consist of cellular organelles that are involved in various functions. The cellular…
Q: Lipid rafts form because membrane component such as sphingolipids and cholesterol molecules…
A: Lipid rafts are assemblies or platforms that have cholesterol, phospholipids and sphingolipids as…
Q: The figure below represents a cell membrane. Each numbered structure represents a type of membrane…
A: protein has different conformation from primary to secondary to tertiary to globular protein
Q: What enzymes are responsible for distributing phospholipids in the correct side of the membrane?
A: Biological membranes include a lipid bilayer which act as a selective permeable barrier to generate…
Q: How are the intrinsic proteins in cell membrane distributed?a) Uniformb) Randomc) Symmetricd)…
A: The cell membrane is quasi fluid, elastic, pliable, and thin partitions over and inside the…
Q: Why are plasma membranes arranged as a bilayer rather than a monolayer?
A: The plasma membrane is the membrane found in all cells that separate the interior of the cell from…
Q: If a doctor injected a patient with what was labeled as an isotonic saline solution, but then the…
A: The osmosis is the process by which water movement occurs in and out of the cells. During osmosis a…
Q: Which portion of the phosphatidylinositol molecule contributes to (a) fluidity of the bilayer and…
A: Phosphatidylinositol is a type of glycerophospholipid that contains a glycerol backbone, two…
Part a) Would a single alpha helix be more stable in a aqueous solution or a membrane. Explain why.
Part b) Why do transmembrane proteins always have secondary structures inside the membrane but aqueous proteins do not?
Part c) If you had a single alpha helix, can it act as a pore for a membrane. Explain.
Trending now
This is a popular solution!
Step by step
Solved in 4 steps
- There is a long chain of amino acids with long sections that are mostly polar, alternating with long sections that are nonpolar. How would this chain be organized if it were destined to become a transmembrane protein? A cytoplasmic protein?What is the primary characteristic of peripheral membrane proteins? A: They cannot be post-translationally modified. B: They span the entire lipid bilayer, sometimes multiple times. C: Detergents or nonpolar solvents are necessary to remove them from the lipid bilayer. D:Weak intermolecular forces keep them attached to the lipid membrane.In the figure below, an integral membrane protein is shown. These proteins sit inside of cell membranes. Some integral proteins are membrane channels or transporters, while others serve as enzymes, receptors, or anchors. Describe the differences you would expect to see in the amino acid side chains on the outer surface of an integral cell membrane protein, as compared to a water-soluble globular protein. Be sure to discuss the chemical nature of the cell membrane in your answer.
- b) Cellular membranes are generally found in environments that contain lots of water. Draw a diagram of what the phospholipid bilayer of a plasma membrane would look like if it were placed in a hydrophobic environment. (**Note that you only have to draw the phospholipid bilayer, you don't have to draw the other major components again as you did in part a) c) What part or parts of a cellular membrane play(s) a role in determining the fluidity of the membrane? 8) Indicate which of the five major types of membrane protein (adhesion, enzymatic, reco receptor, and transport) is most likely to be involved in each of the situations described be a) An oncologist wants to study the cells from a certain tumour that has been surgically re from a patient. However, she must first treat the tumour with a solution affects a membra protein on the tumour cells. Because of the effect of the solution on the membrane protei tumour tissue falls apart into individual cells. Type of membrane protein: ans…Which of these structures would you expect to find as part of the transmembrane portion of an integral membrane protein? Structure B would be part of the transmembrane domain of an integral membrane protein. Structure C would be part of the transmembrane domain of an integral membrane protein. Structure A would be part of the transmembrane domain of an integral membrane protein.The lipid portion of a typical bilayer is about 30 Å thick. (a) Calculate the minimum number of residues in an α-helix required tospan this distance. (b) Calculate the minimum number of residues in a β-strand required to span this distance. (c) Explain why α-helices are most commonly observed in transmembrane protein sequences when the distance from one side of a membrane to the other can be spanned by significantly fewer amino acids in aβ-strand conformation. (d) The epidermal growth factor receptor has a single transmembrane helix. Find it in this partial sequence: . . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . .
- Which of the following best describes the pH of the lysosomal interior? a.) The interior of a lysosome generally has a pH similar to cytoplasm b.) The interior of a lysosome generally has a pH higher than cytoplasm c.) The interior of a lysosome generally has a pH lower than cytoplasmThe lipid portion of a typical bilayer is about 30 Å thick. (a) Calculate the minimum number of residues in an a-helix required to span this distance. (b) Calculate the minimum number of residues in a B-strand required to span this distance. (c) Explain why a-helices are most commonly observed in transmembrane protein sequences when the distance from one side of a membrane to the other can be spanned by significantly fewer amino acids in a B-strand conformation. (d) The epidermal growth factor receptor has a single transmembrane helix. Find it in this partial sequence: .RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH..Name: b) Cellular membranes are generally found in environments that contain lots of water. Draw a diagram of what the phospholipid bilayer of a plasma membrane would look like if it were placed in a hydrophobic environment. (**Note that you only have to draw the phospholipid bilayer, you don't have to draw the other major components again as you did in part a) c) What part or parts of a cellular membrane play(s) a role in determining the fluidity of the membrane? 8) Indicate which of the five major types of membrane protein (adhesion, enzymatic, recogniti receptor, and transport) is most likely to be involved in each of the situations described below: a) An oncologist wants to study the cells from a certain tumour that has been surgically remov from a patient. However, she must first treat the tumour with a solution affects a membrane protein on the tumour cells. Because of the effect of the solution on the membrane protein, the tumour tissue falls apart into individual cells. Type of…
- Proteins, like lipids, are free to move in the membrane. How do we know this?b) Cellular membranes are generally found in environments that contain lots of water. Draw a diagram of what the phospholipid bilayer of a plasma membrane would look like if it were placed in a hydrophobic environment. (**Note that you only have to draw the phospholipid bilayer, you don't have to draw the other major components again as you did in part a) poned In salt wer (ho byorout obods f.Cplan why sctive tnsport is requind in tive tre nolaib beisio c) What part or parts of a cellular membrane play(s) a role in determining the fluidity of the membrane? pslomlo belowWhy do most molecules require the assistance of proteins to cross the cellular membrane? What factors limit diffusion of molecules across the cellular membrane?