n RNA must you have in g e molecule of each seque a nucleotide is 330 a mol a is 330

Highlight each peptide bond in the molecule below. In addition, list the common names of the smaller molecules that would be released if all the peptide bonds were hydrolyzed. You can add more rows to the table if you need to. (Note: you do not need to list water.) If there are no peptide bonds in the molecule, just check the no peptide bonds box below the drawing area. Ono peptide bonds Add Row I Don't Know H₂N-C Submit CH₂ CH C–NH–CH—CO0 CH, CH3 molecules released if peptide bonds hydrolyzed (list one name per row) 0 CH3 00 X S X 3 alo Ar © 2023 McGraw Hill LLC. All Rights Reserved. Terms of Use | Privacy Center Accessibility

Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1

If 200000 molecules of protein A are present in the eukaryotic cell what would be the micromolar concentration of this protein be in the cytosol

Not too sure if my answer is correct.

Which statement is completely false below? O Amino Acid Polymers less than 50 amino acid residues long are called polypeptides O Aqueous Cysteine is a zwitterion but dry Cysteine is not O When Serine becomes aqueous, the side chain alcohol loses its Hydrogen O All are true O Amino Acids when linked in a peptide bond are called amino acid residues

the amino acid is tryptophan

Deoxyadenosine monophosphate (dAMP) and guanosine monophosphate (GMP) are nucleotides. The similarities between dAMP and GMP are that they both have? -an alpha (central) carbon.-the same R group.-a phosphate group.-a pentose (5 sided) sugar-an amino group-a nitrogenous base.