mRNA: amino acids: traits: DNA: | CGA CAA CAC | GTA GTA | CAA AAA ATG | TTA TAG AAT GAC GGG TGG | mRNA: amino acids: traits: DNA: mRNA: amino acids: traits: arch TTA TTG TTA CGG | AAA AGA CCT | GCA GCC TTG TGT | O 10 C w] 58 GR 7 OM O 00
Q: escribe the parasitic cycles of arthropods, including ticks, mites, and bloodsucking insects.
A: Arthropods have jointed appendages. They are characterized by the presence of an exoskeleton made up…
Q: 3. A man heterozygous for both dominant traits of dimples (D) and free ear lobes (E) marries a woman…
A: Introduction Phenotype refers to the observable physical or biochemical characteristics of an…
Q: Environmental input to different sensory systems affects different neuroanatomical pathways.…
A: Sensory pathways are an essential component of the nervous system, allowing us to receive and…
Q: Following administration of an opiate drug, "pain signals" are prevented from getting out of the…
A: Introduction: Opiates are a class of drugs that include natural and synthetic substances such as…
Q: What are the overall inputs (substrates and energy sources) and outputs (products and by- products)…
A: Introduction Cellular respiration is the process by which cells convert the energy stored in…
Q: Two other parents think their baby was switched at the hospital. The mother has blood type “A,”the…
A: The ABO blood type system is a classification system used to categorize human blood based on the…
Q: Give typing answer with explanation and conclusion How do fungi digest their food sources? Select…
A: Fungi are a diverse group of eukaryotic organisms that include yeasts, molds, and mushrooms. They…
Q: 1. two types of marine mammals including (A) basic characteristics, (B) what they eat, and (C)…
A: Note: “Since you have posted multiple questions, we will provide the solution only to the first…
Q: 25. The combination of alternating dark A bands and light _______________ bands gives a muscle fiber…
A: Introduction Muscle contraction is the process by which muscle fibers generate tension or force in…
Q: What arethe three main checkpoints involved for both Mitosis, and Meiosis 1?
A: Cell cycle is a set of events that occur in a cell when it divides and grows. A checkpoint is one of…
Q: All of the following are protozoan diseases of the gastrointestinal tract, acquired by ingesting…
A: Protozoan diseases of the gastrointestinal tract are caused by single-celled organisms and are…
Q: PCR is used. A. all of these B. to solve crimes C. to diagnose genetic diseases D. to study gene…
A: Note:- Please always mention the needed parts in case of multiple questions. Thank you! Polymerase…
Q: Compare and contrast bryophytes (e.g. mosses) and seedless vascular plants (e.g. ferns). What…
A: Mosses and ferns are two groups of plants that have played important ecological roles throughout…
Q: At what stage of fetal development does twinning cease to be biologically possible?
A: Introduction Development refers to the process of growth, change, and maturation that occurs over…
Q: What are two types of weak molecular bonds? Then, describe two examples of how these types of weak…
A: Introduction : Hydrogen bonding : A hydrogen (H) atom covalently linked to a highly electronegative…
Q: In aerobic respiration, does inhaled molecular oxygen (O2) combine chemically with carbon to produce…
A: Both aerobic and anaerobic processes can be used for cellular respiration. It is the method through…
Q: Make recommendations about the future use of the huckleberry plant
A: Huckleberries are a group of small, edible berries that grow wild in many parts of North America.…
Q: What is thermodynamics? Describe the first and second laws of thermodynamics in detail. Describe the…
A: Temperature or heat is referred to as "thermo," while the term "dynamics" refers to the movement of…
Q: A 65-year-old man comes to the physician with a chief complaint of low back pain for the past 6…
A: A systematic process of identifying and evaluating symptoms, medical history, and physical…
Q: Describe the use of anaerobic digesters for producing methane. Define bioremediation. Describe two…
A: As per bartleby guidelines only 3 subparts can be answered. Please post remaining questions…
Q: Stetp by step for each question!
A: Introduction Phenotype refers to the observable physical or biochemical characteristics of an…
Q: What is the way an animal responds to its environment called?
A: Living or biotic elements constitute the biological environment. The biological environment is made…
Q: When it comes to healthcare, why should people even bother with using the internet? How does remote…
A: Health Care: Health care refers to the maintenance and improvement of an individual's physical,…
Q: You are presented with the following clinical scenario: "A 50 year old patient presents with…
A: CD15-positive cells serves as a gauge for the disease's aggressivity and progression. CD15…
Q: Explain how monarch butterflies become toxic to predators. Does the predator die after eating a…
A: The monarch butterfly defends itself from vertebrates using two different techniques. The first…
Q: Which of the following is an example of Genetic drift? A. Red flowers with AA genotype evolve after…
A: Evolution is a steady phenomenon that bring about alteration in life from simple to more complex.…
Q: 0 What is phenotypic plasticity? O When a phenotype is exaggerated in males. O When a phenotype is…
A: Introduction:- Phenotypic refers to the observable characteristics or traits of an organism that…
Q: 1. The garden flower Salpiglosis sinuate ("painted tongue") come in different colors. Several…
A: Given data is as follows: Parents F1 phenotype F2 phenotype Red x blue All red 102…
Q: Give a brief description of how RNAi works in cells specifying the molecules involved
A: RNA interference (RNAi) is a cellular mechanism that controls the stability and translation of mRNA…
Q: i need help finding the the type of metagenomic data that the study gathered in the article and…
A: The article titled "Metagenomics of pasteurized and unpasteurized gouda cheese using targeted 16S…
Q: The following pedigree shows a family in which an inherited condition is apparent. The muscle biopsy…
A: A pedigree chart is the graphical representation of a trait or disease in a family tree. It shows…
Q: Please help me with these questions, more than one answer may be correct: 1) Some of the functions…
A: The ability of living organisms to maintain a relatively stable internal environment despite changes…
Q: An example is pea color in Mendel's experiments. A cross of two homozygotes with different…
A: The segregation of the two alleles of a particular gene into the gametes is described by Mendel's…
Q: Calculate the percentage efficiency of extraction of phycocyanin in sample 3, if the amount of…
A: Phycocyanin is a pigment-protein complex that is found in certain types of blue-green algae, such as…
Q: Karim believes that vaping is not harmful to his lungs. He read some research that suggests that…
A: Introduction The lungs are a pair of vital organs located in the chest that are responsible for the…
Q: Two male deer compete for access to a female by sparring with their antlers. What type of selection…
A: Intrasexual Selection: Intrasexual selection is a type of natural selection that occurs when members…
Q: Illustrate a SARS-CoV-2 virion. Label the ssRNA and the 4 structural proteins. Indicate (write) the…
A: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) has rapidly spread in humans in almost…
Q: Sliding-clamp proteins load polymerase onto the primer and maintain its stable association with the…
A: Answer 1) True. Sliding-clamp proteins, like the proliferating cell nuclear antigen (PCNA) in…
Q: Review the images of the two biomes, the tundra and the taiga. Noti that while there are about 1,700…
A: In ecology, a biome is a large geographic region with distinct plant and animal communities that…
Q: A flask containing an aquatic plant in water is placed next to a light. A sensor that detects the…
A: Chloroplasts are special organelles in plant cells that can convert solar energy into chemical…
Q: future use of the huckleberry plant
A: The huckleberry plant is a wild shrub native to North America that belongs to the Ericaceae family.…
Q: If you wanted to use the molecular clock to estimate times of divergence for phylogenetically…
A: Introduction: A gene is a segment of DNA that contains the instructions for the development,…
Q: provide a full Description of the simiarlities and differences between the fish, pork and beef tap…
A: A tapeworm is a parasitic flatworm that lives in the intestines of animals, including humans. They…
Q: A 54-year-old woman comes to the physician because of painful blisters on the trunk that appeared 3…
A: A skin condition refers to any abnormality or disease that affects the skin. The skin is the largest…
Q: Write the correct Latin names for the major divisions of life. Protists are not included on this…
A: There is no definitive reason why and when life on earth originated. According to Aristotle, life…
Q: Match the chelicerate to its respective identifying character. Araneae Scorpiones Pseudoscorpiones…
A: Chelicerates: Chelicerates are a diverse group of arthropods that include spiders, scorpions, ticks,…
Q: Based on the alignment of these protein sequences below, which [pairs] of the genes appear to be…
A: Based on the alignment of the protein sequences provided in the image, it appears that: SEQUENCE 2…
Q: Do you think some ingrediants in foods, that prolong the life of that food, make it easier or harder…
A: Preservatives: Preservatives are substances added to food and other products to prevent spoilage,…
Q: Question 4 Consider a gene with two alleles, H and J. The table below describes fitness for…
A: This question pertains analyzing fitness and allele frequencies in two gene populations with two…
Q: What aspect of a cell's physical makeup increases gradually as it gets smaller? 2. How could…
A: Bacterial cells are single-celled microorganisms with a simple structure that lacks a nucleus and…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- GENE F DNA GGACGCGGG MRNA Amino Acid TraitAa Po AaBbCcDc AaBbCcDdEe AaBbCcDdE AaBbCcDdE AaBbCcDdE BIUVab x, x A ev A 三==|這、|の Caption Emphasis Heading 1 Heading 3 Heading 4 Style Pane (a) Complete the table, using a letter D, R or B, to show whether each statement applies to: Fo DNA only (D) TA2G – Completed forms must be available for Open Awards external moderation purposes. Page 6 of 15 > T | RNA only (R) Both DNA and RNA (B) Statement D or R or B Contains thymine Contains ribose Consists of two chains connected to each other with hydrogen bonds Has a sugar-phosphate backbone Has four different nitrogenous bases Contains a pentose sugar Is found in the nucleus and cytoplasm English (United Kingdom) Focus 目民 2490 words +1ment/d/1d1MOGCJCGjZYwhcUOWDBulan-NwWpIRg/edit utations .DOCX t Tools Help Last edit was 9 minutes ago nal text Times New... | c ñ I a + 二次 =t|^三| 11 1. Will there ikely be etects? 5. What type of mutation is this? 2. 4. Mutated DNA Sequence #2 TACGAC CTTGG CGA C GACT What's the mRNA sequence? amino acid sequence? Will there likely be effects? What type of mutation is this? Mutated DNA Sequence #3 TACA CCTTAGCGA CGACT... (Highlig. What's the mRNA sequence? amino acid sequence? Will there likely be effects? What type of mutation is this? Mutated DNA Sequence #4 TACAC CTTGG CGACTACT... (Highligh. What's the mRNA sequence? amino acid sequence? Will there likely be effects? What type of mutation is this? dy
- ACG< QNA RNA type f base Tyre of Engan desry- bJA Seatwork: DNA or RNA strand ONA NH2 hnu - RU4 NH 4. N- 2 - NH2 но -р-о но- OH онон NH2 H2N 1. NH N: но но 0-P-0-P- OH OH онон6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…GENE G DNA GTCGTCTII MRNA Amino Acid
- co X E Unique Jones Tapia - [Template] x M Inbox (391) - uj0893@tjuhsd-stu x gle.com/document/d/17Z8rYsZ27avzUkme2WL12HQLUWZyFn16_AqtBTZ5EBo/edit ortals A google classroom Zoom Y Educator's Guide. O BabyCenter | The M.. A Aeries Student Das. e Kami Extensio pia - [Template] Worksheet: Co-dominance, Incomplete, Multiple Alleles O Last edit was 7 hours ago usert Format Tools Add-ons Help BIUA 三。 三 E - E - E E % Normal text Arial 11 2. 1.3 Practice: Co-Dominance, Incomplete Dominance, and Multiple Alleles 1. When shorthorn red cattle are bred to shorthorn white cattle, they produce roan (red & white hairs) offspring. What type of inheritance is this? (circle one) Co-dominance Incomplete Dominance Multiple Alleles a. If two roan shorthorns are crossed, what is the probability of red, white, and roan colors in their offspring? Genotypic ratio: Phenotypic ratio: 2. In a petunia, a pure breeding red flower is crossed with a white one to produce pink offspring. What form of inheritance is…Word AaBbCcI AaBb CcD AaB AaBbCсI AaBbCcL 4 1 Normal Subtitle Title 1 No Spaci... Subtle Em..... Create and Share Adobe PDF Styles Adobe Acro P 1 1 2 4 A 3. A AL T L 4 E 5 E Question 6: The largest chromosome in Mischievous gremlinus has a length of 9 x 107 base pairs. The rate of DNA synthesis is 3,000 bp per minute at each replication fork. a. How long does it take to replicate the entire chromosome from a single origin of replication located exactly in the middle of the chromosome? Assume no pauses. I b. Experiments performed by Professor Trink reveal that it takes only 20 minutes for a growing cell to replicate this chromosome. What is the minimum number of replicons present on the chromosome? Florian Fischer Find v Replace Select Editing 153 23Oh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…
- Compare the two DNA sequences shown below and consider the single nucleotide mutation made in the lower DNA sequence (shown in bold font). This is an example of a mutation. DNA: ATG CGC ТСС САТ стт ААС АAА GAG GTT GG C TAT TT Protein: Met-Arg-Ser-His-Leu-Asn-Lys-Glu-Ala-Gly-Tyr-Phe DNA: АTG CGC ТСС САТ стТ ААС АAG GAG GTT GGC ТАТ ТТT Protein: Met-Arg-Ser-His-Leu-Asn-Lys-Glu-Ala-Gly-Tyr-Phe missense nonsense frame-shift silent antisenseGENE H DNA CGCCCCTAT MRNA Amino AcidGAG Glu GGG Use the genetic decoder provided to assist in answering this question.\ Second letter UGUT UGC Cys Stop UUU UTo UCU UAU Tyr ULIC Phe UACJ Ser UCC UAA Stop UGA A UAG Stop UGG Trp G UUA nan onn UCG OLeu UCA CAU CGU) CACHS Pro CAA CUU CCU His C CUC Leu C CUA LEUCCA ) Gin CAGJ CGA Arg CUG CGG ACU AAULAso AGUser AUU AUC le AUA AUG Met ACG ACC ACA The AAA AGA AAGJ AGG JArg 6 FLys GAUAn GU GUU GUC GCU GCC Asp Val GUA GAC Ala GAA Glu GAG GGC A Gly GGA GGG GCAA GUG GCG What do you predict would happen if you created a tRNA with an anticodon of 5'-AGG-3' that is charged with methionine, and added this modified tRNA to a cell-free translation system that has all the normal components required for translating RNAS? We did one like this in class... we have to think'about the directionality (5' -> 3' or 3' -> 5'). The easiest way is to draw out your anticodon and codon first, and then consider are the strands going to line up parallel or anti-parallel. O a. methionine would be…