Q: Are there any other medical significance of using Reagent Test Strip, aside from its use in Diabetic…
A: In this question it is asking that the mention a medical significance of reagent test strip aside…
Q: mechanism by which Covid-19 affects the body system
A: These are a particular group of viruses that is capable of causing minor common cold to severe…
Q: Please describe the second messenger pathway (mechanisms) after the GH/IGF binding its receptor and…
A:
Q: Explain using 2-3 sentences the biological significance of the following peptides . Glucagon…
A: Peptides are short chains of amino acids linked by peptide bonds. Peptides are smaller than…
Q: role of doctors and nurses in the treatment of COVID-19
A: Covid19 or coronavirus disease is an infectious disease with symptoms like fever, dry cough,…
Q: what test should i get to see if i have covid-19?
A: A novel coronavirus, SARS-CoV-2 is the etiologic organism of COVID-19, which is an infectious…
Q: Briefly discuss about the biochemical functions of adrenocorticosteroids.
A: Adrenocorticosteroids are cortical steroids produced by the adrenal cortex. They help in maintaining…
Q: What is your reaction about Covid-19?
A: Viruses are unicellular organisms that are known to replicate only in the host cells. They consist…
Q: What are adverse effects associated with the use of Tocilizumab and dexamethasone in COVID-19.
A: Coronavirus disease (COVID-19) is an infectious disease caused by a newly discovered virus called…
Q: Is dopamine a precursor to norepinephrine
A: Since we answer the first question in case of multiple questions. If you want any specific question…
Q: What are the similarities between the adrenal hormone cortisone and the synthetic corticoid…
A: The steroid hormones are derived from cholesterol which are secreted by the adrenal, cortex, testes…
Q: What is "tocilizumab"? Specify its nomenclature and explain its role in the treatment of COVID-19.
A: COVID-19 illness produced by a novel strain. COVID-19 has varied effects on various persons. The…
Q: Hypothalamus TRH Anterior pituitary TSH = Thyroid gland Thyroid hormones Stimulates Target cells --…
A: Introduction Hormones play important role in normal physiology in our body. They control various…
Q: Discuss insulin resistance, hyperinsulinemia, anovulation, and androgen production in PCOS.
A: Polycystic ovary syndrome (PCOS) is a condition found only in women that affects the hormonal…
Q: What are the steps involved in synthesis of genetically engineered insulin.
A: The researchers have discovered several methods/processes to manipulate the DNA sequences using the…
Q: From what amino acid is melatonin derived? Describe the modifi -cations that have occurred.
A: Melanin is a group of natural pigments found in most organisms. It is a skin pigment. It occurs in…
Q: What is calcitonin/ calcitonin gene-related peptide (CT/CGRP) ?
A: The genes are the hereditary unit of an organism. Expression of the genes produces the phenotypic…
Q: What are sex steroids synthesised from?
A: On the basis of their receptors, the steroid hormones have been organized into five groups:…
Q: scientist working for a pharmaceutical company, you are asked to enginner bacteria that will produce…
A: Human growth hormone is a protein hormone which is produced by anterior pituitary gland. Growth…
Q: Among all the endocrine glands one particular gland is more susceptible towards abnormal function -…
A: There are many types of endocrine signaling in the body, which plays different functions in…
Q: ive some abnormal conditions wherein the APTT is prolonged. Why is APTT employed in monitoring a…
A: Activated partial thromboplastin time are the test which is used for testing the .In APTT , an…
Q: Details about parkinson's disease(PD) pharmacotherapy that links with COVID-19. Please include…
A: In physiology, Parkinson's disease is defined as the neurological disorder or condition of the…
Q: Name of a natural or synthetic molecule that interacts with Insulin? (please include your…
A: Insulin is a human body hormone secreted by Pancreas. It helps in body glucose utilisation for…
Q: A mutant form of polypeptide hormone has the following amino acid composition: Asp, Arg, lle, Met,…
A: The amino acid composition of a mutant peptide is Asp, Arg, Ile, Met, Phe, Pro, Tyr, Val. It is an…
Q: 1.Base on the picture below, please identify secretin, epinephrine, and cortisol as a peptide, amino…
A: Hormones are non nutrient chemicals which regulate an array of functions in a living system.
Q: 1. α-ketoglutaric acid participates in the processes of transdeamination and transreamination of…
A: We’ll answer the first question since the exact one wasn’t specified. Please submit a new question…
Q: Write a summary on Structure Activity Relationship (SAR) of Progesterone ? Or write a short note on…
A: Progestrone is a class of steroidal hormones.steroid hormones in mammals are biosynthesised from the…
Q: What is Stem cell therapy for Covid-19? and What could be its possibilities and challenges?
A: Severe Acute Respiratory Syndrome coronavirus(SARD-CoV)-19 is the virus responsible for novel corona…
Q: How does COVID 19 affect the endocrine system? Please be specific and add the references
A: The COVID-19 virus is responsible for the current global pandemic and is quite dangerous…
Q: Please explain. Be concise. Make sure your drawings are legible. What are the hormones formed from…
A: Hormones are the molecules of the endocrine system that acts a chemical messenger. These are…
Q: Explain why use of a 5 alpha reductase inhibitor is a treatment for benign prostate hyperplasia
A: Prostate is defined a small gland that is present inside the groin located between the bladder and…
Q: are there long term effects of covid-19
A: Various researches and studies have been conducted to observe long term effects in COVID-19…
Q: Write a summary on Structure Activity Relationship (SAR) of Androgen? Or write a short note on SAR…
A: Certain compounds have a distinct relationship between their activities and their structural form.…
Q: Explain the phosphatidylethanolamine ?
A: A phospholipid is a type of lipid molecule which is the major constituent of the cell membrane.…
Q: Why is zinc being used as prophylaxis for COVID-19?
A: The coronavirus disease is the largest pandemic infectious disease which affected the largest…
Q: What are Local Transmission of Covid-19
A: Some useful terms related to COVID-19 SARS ( Severe acute respiratory syndrome), CoV ( covid 19)…
Q: Why is there caution against prescribing imatinib with strong CYP3A4 inhibitors?
A: Imatinib is a oral chemotherapy medication which is used for the treatment of cancer.It prevents or…
Q: Discuss the biosynthesis of epinephrine. Give one important medical use of epinephrine.
A: Introduction Epinephrine is also known as adrenaline. This is a hormone as well as medication.…
Q: List the advantages of recombinant insulin.
A: Insulin is a natural hormone secreted by the endocrine cells of the pancreas. The function of…
Q: who can harbor/carry the covid-19?
A: Severe acute respiratory syndrome coronavirus-2 is a novel severe acute respiratory syndrome…
Q: how does COVID19 affect the endocrine system . please be specific and add the references
A: A novel disease COVID-19 is caused by SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2)…
Q: Write down the mode of action of Atorvastatin? Please write at your own words.
A: Atorvastatin, marketed under the trade names Lipitor and others, is a statin medicine used to…
Q: what causes the covid-19?
A: Virus are small entities containing either DNA or RNA as genetic material . It has characteristics…
Q: Explain why a young child taking prednisone(glucocorticoid) for chronic kidney inflammationis at…
A: We known that Corticosteroids are steroidal anti-inflammatory drugs. Some of the naturally occurring…
Q: Write down the mode of action of Atorvastatin. Please briefly explain at your own words.
A: Atorvastatin is a statin that is used for the prevention of coronary heart disease. Coronary heart…
Q: What are the possible interferences or sources of variability in the assay? How do these…
A: In laboratory medicine, mining, pharmacology, environmental biology, and molecular biology, an assay…
Q: Write a note on polypeptide hormone receptor
A: receptor is basically the protein that binds to the specific molecule which is known as ligand and…
Help me How does COVID 19 affect the endocrine system? Please be specific and add the references?
Step by step
Solved in 2 steps
- Write a summary on Structure Activity Relationship (SAR) of Progesterone ? Or write a short note on SAR of Progesterone ? Please write at your own words. Answer should be specific (8-10)lines.Write a note on polypeptide hormone receptorDesign a pair of primers to amplify the human Insulin gene (only the blue region) Human Insulin CDNA (gene sequence, 5'-untranslated region, 3'-untranslated region) 5'agecete agccctccaggacaggctgcatcagaagaggccatcaagcagatcactgtccttctgccATGGCCCTGTGGA TGCGCCTCCTGCCCCTGCTGGCGCTGCTGGCCCTCTGGGGACCTGACCCAGCCGCAGCCTTTGTGAACCAAC АССТСTGCGGCTCАCАCСТGGTGGAAGCTCTCТАССТАGTGTGCGGGGAACGAGGCTTCTTCTACАCACСCА AGACCCGCCGGGAGGCAGAGGACCTGCAGGTGGGGCAGGTGGAGCTGGGCGGGGGCCCTGGTGCAGGCAGCC TGCAGCCCTTGGCCCTGGAGGGGTCCCTGCAGAAGCGTGGCATTGTGGAACAATGCTGTACCAGCATCTGCT CCCTCTACCAGCTGGAGAACTACTGCAACTAGacgcagcccgcaggcagccccccacccgccgcctcctgca ccgagagagatggaataaagcccttgaaccaacaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaŋ' Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN* 5'-C 5'-I ]-3' ]-3' Primer: I Primer: 2 I know the answers are 5'-ATGGCC-3' for primer 1 and 5'-CTAGTT-3' for primer 2 but I'm not sure why. Could some explain why?
- How does COVID-19 cause deathCan I get help please with this question? Two mutations have occurred to proteins within the glucagon signaling pathway: A) The glucagon receptor has a mutation. This mutation causes this GPCR to always have a conformation that will induce nucleotide exchange for any associated heterotrimeric G proteins, even without glucagon binding to the receptor. B) The alpha subunit of the heterotrimeric G protein has a mutation. This mutation causes the Gαarginine finger to always be in a position to properly order the catalytic residues within the Gαsubunit to promote catalysis. Question: What will the combined effect of both mutations be on the signaling pathway and what is the mechanistic reason for this effect?Can I get help on how to do this question? Two mutations have occurred to proteins within the glucagon signaling pathway: A) The glucagon receptor has a mutation. This mutation causes this GPCR to always have a conformation that will induce nucleotide exchange for any associated heterotrimeric G proteins, even without glucagon binding to the receptor. B) The alpha subunit of the heterotrimeric G protein has a mutation. This mutation causes the Gα arginine finger to always be in a position to properly order the catalytic residues within the Gα subunit to promote catalysis. Question: What will the effect of the Gα mutation be on Gα's function and what is the mechanistic reason for this effect?
- Can I get help on how to do this question? Two mutations have occurred to proteins within the glucagon signaling pathway: A) The glucagon receptor has a mutation. This mutation causes this GPCR to always have a conformation that will induce nucleotide exchange for any associated heterotrimeric G proteins, even without glucagon binding to the receptor. B) The alpha subunit of the heterotrimeric G protein has a mutation. This mutation causes the Gαarginine finger to always be in a position to properly order the catalytic residues within the Gαsubunit to promote catalysis. Question: What will the effect of the glucagon receptor mutation be on the GPCRs function and what is the mechanistic reason for this effect?+ Acellus - The Science of Learning x asd-sp-01 -7.acellus.com/StudentFunctions/Interface/acellus_engine.html?ClassID=751477912 The Endocrine System Acellus After an endocrine organ that is making a hormone, like protein, has the gene in the cells of that organ transcribed to make RNA, then the RNA has to be translated into A. vitamins B. fats C. amino acids Copyright©2003 - 2021 Acellus Corporation. All Rights Reserved.How have the following changed over the years? think if potential factors resulting in this change about COVID-19: - Has the incidence/prevalence of the condition increased, decreased or remained constant? -Has the mortality resulting from the condition increased, or decreased, or remained constant?
- What are adverse effects associated with the use of Tocilizumab and dexamethasone in COVID-19.List the advantages of recombinant insulin.A web.lrnr.us/courses/6241c4b1-ef4f-41db-8549-34b0c315b9f4/assignments/da0b072b-ad10-40b1-a0cb-ecc2d2baf7f5/activities/c04d4b52-bb67- irrnr laquajajones Courses > Human AP I Laboratory > Assignments > 01 Microscope Lmr HW > Peering Into the Invisible World C9 Peering Into the Invisible World FIB with muitiple drop down entries 0. My Fill in the blanks, using the choices provided, to correctly identify the contributions to the Cell Theory. G2 In the late 1600s, a Dutch tailor who crafted lenses, used his primitive microscope to view pond water, the plaque In 1665, from his own oral cavity, as well as his own sperm. He referred to all of the organisms he viewed as coined the term to describe the cork tissue he was observing through a lens. You sign 91°F P Type here to search