Q: give one species that is classified or exhibit the following: infanticide show a photograph of it…
A: The infanticide is also a animal behaviour that constricts a group of animals which kill their…
Q: Why do anandromous lampreys die after breeding in the freshwater environment
A: Anadromous fishes are born in freshwater. They spend most of the time in salt water but they return…
Q: A cartilaginous fish that has a gill covering and fin rays os a ? Group of answer choices Clown fish…
A: Cartilaginous fishes have skeletons made of cartilage rather than bone . They have paired fins ,…
Q: Which one of the following is a marine fish: (please refer class 12th NCERT) a. Rohu b. Hilsa…
A: Step 1 Pisces or fishes are a group of jawed aquatic vertebrates that are characterized by the…
Q: What is the giant freshwater stingray
A: INTRODUCTION giant freshwater stingray is the largest fish swimming in freshwater on earth.
Q: Give 5 to 9 sentences on Flatworms, Flukes, Planarians, and Tapeworms and the phylum…
A: A worm is a type of unrelated invertebrate animal with a soft, slender, and elongated body. Worms in…
Q: Name the country having maximum population.
A: The world is divided into continents and continents are divided into countries. Asia is the largest…
Q: Why would you not eat raw oysters as is common in Maryland?
A: The state of Maryland thinks that oysters are not only important to eat, but also oysters to keep…
Q: Give reasons why anandromous lampreys die after breeding in the freshwater environment
A: The sea Lamprey is one of the fishes that are categorized as anadromous, as these fishes spent a…
Q: Bivalves are often used as indicators of environmental quality. Based on your knowledge of bivalve…
A: Introduction Scallops, clams, mussels, and oysters are all classified as bivalve. Their name comes…
Q: [ Select ] The realized niche of Cthamalus is [ Select ]
A: Niches and habitat
Q: EMU, Liver fluke, Octopus, polar bear, raw pore rope sponge, and green frog).
A: DATA CHART OF ORGNISM_
Q: Could Water Temperature Affect the Prevalence of Anisakids Nematodes in Fish? please cite sources
A: Anisakidosis is a zoonotic parasitic infection spread by members of the Anisakidae family. Anisakis,…
Q: Which of the following organisms cohabitate with the tripod fish? goldfish anglerfish swordfish…
A: Tripod fish is a benthic fish, i.e., lives on the ocean floor. Its habitat is in temperate and…
Q: Which one of the following is a marine fish: (please prefer class 12th NCERT) a. Rohu b. Hilsa c…
A: The phylum chordates or vertebrates come under kingdom Animalia that include animals with backbone…
Q: Describe three social factors that make feeding more enjoyable for an infan
A: Feeding the infant is the most difficult and important in the care of an infant. Feeding influences…
Q: Briefly Explain how improving the diagnosis of diseases in fishes and making availability of…
A: Aquaculture is rapidly growing agriculture worldwide. Aquaculture is breeding, raising, and…
Q: Describe FISH analysis
A: The study of the structure and function of the chromosome to understand the pattern of inheritance…
Q: Describe how climate change is negatively affecting caribou reproductive success.
A: Reproductive cycle and environment: The reproductive cycle defines the changes that occur leading to…
Q: What causes a large variation in the size of catfish in a pond?
A: Understanding the causes of variation within a population of channel catfish (Ictalurus punctatus)…
Q: Select the correct answer from the answers provided. All adult helminths produce a. cysts and…
A: Introduction: Helminths belong to invertebrates and possess a characteristic body that is either…
Q: Discuss the harm that is caused to a leech by pouring salt on it.
A: Leech is a blood-sucking organism which is hemophagic. It feeds on the blood. It is mostly found at…
Q: With the aid of figure , discuss on survivorship ciurve
A: A survivorship curve is a graph showing the number or proportion of individuals surviving to each…
Q: Choose correct answers. | Pitfall traps can collect ground dwelling insects, such as carabid and…
A: Insects Insects are the largest group of arthropada having 6 legs.
Q: What is the life cycle of sea lampreys, and the various control methods for lampreys intersect with…
A: Lamprey or Petromyzon which is commonly known as jawless fish . Lamprey is parasitic in nature use…
Q: Complete the following sentence. The figure illustrates that when orcas started eating sea otters,…
A: addition or removal of apex predator that is the key stone species which causes the change in type…
Q: Species Diversity of House-dwelling lizards in Cagayan De Oro City
A: Title - Species Diversity of House-dwelling lizards in Selected Urban Areas of Cagayan de…
Q: 36.Cadicone , referring to a loosely coiled , evolute ammonoid resembling a coiled snake Select one…
A: Ammonites are a group of extinct marine mollusks in the subclass ammonoidea of the class…
Q: Some insecticides that act by preventing molting also can harm crustaceans accidentally exposed to…
A: The members of phylum arthropoda are bilaterally symmetrical, invertebrate. They have an open…
Q: Wild ungulates water depedency.
A: * wild ungulates respond to seasonal changes in temperature and precipitation by behavioural…
Q: What kind of consumer an adult frog is? Support your answer.
A: Consumers are those organisms that ingest other organisms and therefore, called heterotrophs. They…
Q: Weighing gold fish prior to conducting experiments on them is done ...
A: Introduction Metabolism is the process by which living organisms obtain energy to drive their…
Q: effect does the food industry have on Cuttlefish?
A: Cuttlefish belong to the order Sepiida. They have a very hard bone known as cuttlebone for…
Q: Describe three foraging strategies used by predatory Photuris fireflies.
A: Foraging is the process where a person or animal searches, collects and identifies the food…
Q: Body weight and length were measured on six mosquito fish; these measurements are given in the…
A: A correlation coefficient is a statistical relationship between two variables. The statistical…
Q: Generate a discussion and conclusion about various types of parasitic helminths include…
A: The scientific classification of animals begin in the late 18th century. At that time, animals were…
Q: what is the status or history of salmon fish in pakistan?
A: Salmon is the common name for several species of fish of the family Salmonidae. Several other fish…
Q: What benefit does parental care for eggs provide? What are the consequences
A:
Q: What causes the loss of spines in lake stickleback fish?
A: Sticklebacks belong to family of fish that belong to the class Actinopterygi. They are commonly…
Q: List some cool water fish.
A: Those fish that can survive in the cold water environment are called cold water fish and they become…
Q: What type of grazing fish is this?
A: Grazing fish eat a wide variety of food organisms by biting them. They usually go in groups.…
Q: Explain the biological aspects of fish that give them advantages over other agricultural animals.
A: Fish farming or pisciculture involves the culture of fishes in the tanks or ponds for the production…
Q: State the consequences of over population.
A: Overpopulation refers to the condition in which a species population is more than the carrying…
Q: [ summary ] current or ongoing research about mungbean
A: Use of Phenomics for Differentiation of Mungbean (Vigna radiata L. Wilczek) Genotypes Varying in…
Q: List and explain 5 ways by which we can dispose refuse
A: Due to the increase in resource consumption, the waste generation has also increased and many of…
Q: Discuss the methods used in breeding and raising fish.
A: Fish are one of the most healthy and nutritional sources of food as they are rich in proteins and…
Give three possible reasons for there being fewer two year old than one year old fish. Give reasonable answers.
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- 3796/variants/609314/take/8/ Refer to the food web at the top of the page. Which terms describe the mountain lion? Select all that apply. Food Web Wolf Mountain Lion Cat Whiptail Ringtail Pine A Marten Eagle Jackrabbit ぐ Nm! Rat Frog Butterfly Squirrel Deer Nuthatch O0 0 0 All Changes Saved weredPO1583 ILIA HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP PO1583 ILIA_HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP PO1583 ILIA HUMAN P16598 ILIA RAT PO1582 ILIA MOUSE P18430 ILIA PIG P48089 ILIA MACMU Q28579 ILIA SHEEP 1 1 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNOKSFYHVSYGPLHEGCMDQSVSLSISETS MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETS MAKVPDLFEDLKNCYSENEDYSSAIDHLSLNQKSFYDASYGSLHETCTDQFVSLRTSETS MAKVPDLFEDLKNCYSENEEYSSDIDHLSLNOKSFYDASYEPLPGDGMDKFMPLSTSKTS 1 MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNOKSFYDVSYGPLHEGCMDQSVSLSISEIS MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNOKSFYDASYEPLREDHMNKFMSLDTSETS 1 1 (i) (ii) 699996 : KTSKLTFKESMVVVA---TNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFS KMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEE-TIQPRSAPHS KMSNFTFKESRVTVSATSSNGKILKKRRLSFSETFTEDDLQSITHDLEE-TIQPRSAPYT KTSRLNEKDSVVMAA---ANGKILKKRRLSLNQFITDDDLEAIANDTEEEIIKPRSATYS…11.0 G. fortis 10.0- 1978 1976 9.0F 8.0 8.0 9.0 10.0 11.0 Midparent bill depth (mm) Geospiza is a genus of finches that inhabit the Galapagos Islands. In 1976, finches were grouped together based on the average depth of their bills. The data from the first generation of grouped finches are plotted on the X-axis. The bill depths of the offspring from each group are plotted on the Y-axis. In 1978, the experiment was repeated after a drought on the Galapagos Islands. The red line represents the data from 1976 and the blue line represents the data from 1978. The slope of both the red line is 0.90 and the slope of the blue line is 0.90. Was there any change in the heritability of the bill depth trait after the drought? Explain your reasoning. Offspring bill depth (mm)
- The three key themes of Pacific salmon biology are anadromy, philopatry (homing), and semelparity. Describe how each of these themes define the salmon’s life cycle in no more than 2 sentences per term.O Bronny Before Going Against L x + Close A Did you finish your interim? if a Edcite Q 12 | 2021 SCLG8 2 x xO Classkick C Clever Portal edcite.com/apps/MOElemViewer?assignid nhaadmin_1611780315611&exid=nhaassessments 15711556315558acode C6G7L7 The data table below includes the estimated populations of woolly monkeys and long-horned grasshoppers in a small area of the Amazon. The data includes numbers from both before and after a fungus harmed the health of the long- horned grasshoppers. Use the information below to answer the question. Organisms such as dead-leaf moths and peacock katydids depend on dead leaves on the ground floor of the Amazon for camouflage. Before Fungus After Fungus Number of Woolly Monkeys Number of Long-Horned Grasshoppers Number of Woolly Monkeys Number of Long-Horned Grasshoppers 4395 35 2377 25 Analyze and interpret the data to draw a conclusion about the relationship Dead-leaf moth (left) and peacock katydid (right). between woolly monkeys and long-horned…RD9 TBD1 0.99 RD7 RD8 RD10 0.99 0.99 M. canettii L4 12 13 L1 L7 L5 b Chimpanzee bacillus M. bovis M. caprae L6 ¹ M. pinnipedii Ancient Peruvian human remains M. microti M. mungi M. suricattae Dassie bacillus M. orygis 0.005 Gagneux 2018 Nat Rev Microbiol In this figure you can see a phylogenetic tree of Mycobacterium tuberculosis, the causative agent of tuberculosis (TB) and a few related mycobacteria. (You may or may not have seen this figure in a previous question in this exam.) In the tree, the M. tuberculosis lineages that are currently circulating in humans are indicated in color and are named L1 to L7. The pie charts on the world map indicate for each of these lineages where they occur. In the phylogenetic tree, names of Mycobacterium (M.) strains derived from non-human animals and from an ancient Peruvian mummy are written in full and are not colored. Which of the following statements is correct? The L4 lineage is more closely related to the L3 lineage than to the L2 lineage…
- Each ionizable group of an amino acid can exist in one of two states, charged or neutral. The electric charge on the functional group is determined by the relationship between its pK and the pH of the solution. This relationship is described by the Henderson-Hasselbalch equation. Histidine has three ionizable functional groups. Complete the equilibrium equations by assigning the proper pK₁ for each ionization and the net charge on the histidine molecule in each ionization state. 1-1-OH H₂N-C-C-OH 1 CH₂ + HN -NH O H || H₂N-C-C-0- | CH ₂ HN -NH O O H || H₂N-C-C-0- 1 CH₂ -NH □ H H₂N-C-C-0- Lio CH ₂ O -NHA group of researchers are interested in whether temperature has an affect on time to metamorphosis in a species of frog. Eggs from a single pond were obtained and raised at either 15°C or 25°C until metamorphosis completed. Time (days) 15°C 25°C 360 379 375 353 354 299 378 349 385 323 359 298 371 301 355 375 μ 367.1 334.6 S 11.66 33.85 Time to metamorphosis at 25°C quantile Time to metamorphosis at 15°C quantile 385 380 375 370 365 360 355 +3 -1.5 380 360 340 320 300 -1.0 -0.5 00 05 10 1.5 Normal quantile -1.5 -1.0 -0.5 00 0.5 1.0 Normal quantile a) List the potential statistical tests that could be used to test the researcher's hypothesis, how they compare in terms of power, and the assumptions made by those tests. (3 marks) b) Based on the data, which test should be used? Provide a brief explanation and test any assumptions, as necessary to come to your conclusion. (4 marks) c) Conduct a statistical analysis using that test. (8 marks)RD9 TBD1 0.99 1 RD7 RD8 RD10 0.99 1 1 M. canettii L4 L2 L3 L1 L7 L5 b Chimpanzee bacillus M. bovis M. caprae L6 M. pinninedii Ancient Peruvian human remains¹ M. microti M. mungi M. suricattae Dassie bacillus M. orygis 0.005 Gagneux 2018 Nat Rev Microbiol In this figure you can see a phylogenetic tree of Mycobacterium tuberculosis, the causative agent of tuberculosis (TB) and a few related mycobacteria. (You may or may not have seen this figure in a previous question in this exam.) In the tree, the M. tuberculosis lineages that are currently circulating in humans are indicated in color and are named L1 to L7. The pie charts on the world map indicate for each of these lineages where they occur. In the phylogenetic tree, names of Mycobacterium (M.) strains derived from non-human animals and from an ancient Peruvian mummy are written in full and are not colored. Look at the two lineages circled in red in the phylogenetic tree. The L4 lineage is the dominant lineage of tuberculosis in…
- Which of the following statements does not support the conclusion that giraffes are k-selected species? Giraffes are approximately 6' tall and weigh 150 Ibs at birth Wild giraffes begin mating at 6-7 years of age Newborn giraffes are capable of coordinated walking within an hour of birth, and running within 24 hours of birth Giraffes rarely give birth to twins.https://www.ehn.org/plastics-in-fish-2656825836/population-level-impacts 1. The main purpose of the article/author's thesis 2. Description of specific evidence/findings presented in the article.The life table below is for a species of lizard. Use it to answer the questions below. It can be copied and pasted in excel or downloaded here. What percentage of individuals can be expected to make it to age 5? nx bx 678 1 102 2 31 3 19 10 4 14 12 12 12 6. 10 14 7. 10 10 8. 8. 11 9. 10 1.8 21 12 5.3 MacBook Air DD 000 80 F8 F9 F F4 F5 F6 F7 F3 24 & 4 7 8 < CO
