From a study of protein A as a function of temperature, we find that the ratio of unfolded protein (Keq = [U]/[F]) is 3.23 x 10-8 at 27°C and 8.80 x 104 at 57°C. Determine AHⓇ, AS and TM for this protein. What is the value of Keq at 70°C?

Reaction of the intact peptide with 1-fluoro-2,4-dinitrobenzene followed by hydrolysis creates Ala and Lys derivatives. Draw the structures of the derivatives and explain what can be deduced from this observation.

For each of the following representations (from OpenStax Biology) indicate whether it is describing primary, secondary, or tertiary protein structure 

Some Protein P binds to 1 molecule of X. The fractional binding curve (θ vs. [Ligand]) shows that θ = ⅓ when [X] = 6 mM. What is the Kd for X binding to P?

The composition in mole fraction units of the strands of a double-helical DNA is [A]= 0.30 and [G] = 0.24. A) What can you say about [T] and [C] for the same strand? B) What can you say about [A], [G], [T] and [C] of the complementary strand?

write structural formulas for all the ionic forms of glutamic acid, and calculate its isoelectric ph.

Amino Acids and Proteins 1. What are the structural features of amino acids with an emphasis on essential amino acids? 2. Write the properties of amino acids: zwitterion, pka, pKb, amphoteric character, isoelectric point, and electrophoresis. 3. Write the mechanism of peptide bond formation and what are its structural features. 4. What are the different types of proteins and their function? 5. Explain the meaning and importance of the primary, secondary, tertiary, and quaternary structures of a protein and the factors that cause its denaturation.

Use the online JPRED 4 secondary structure prediction tool (Pred: A Protein Secondary Structure Prediction Server (dundee.ac.uk) to predict the secondary structure for the following input sequence: MNLVLMGLPGAGKGTQAEKIVAAYGIPHISTGDMFRAAMKEGTPL GLQAKQYMDRGDLVPDEVTIGIVRERLSKDDCQNGFLLDGFPRTV AQAEALETMLADIGRKLDYVIHIDVRQDVLMERLTGRRICRNCGAT YHLIFHPPAKPGVCDKCG GELYQRADDNEATVANRLEVNMKQMK PLVDFYEQKGYLRNINGEQDMEKVFADIRELLGGLAR How many helical regions are predicted? (Hint: see the View Simple Results in HTML). A 4 B 6 C O D 8 E 1

If 200000 molecules of protein A are present in the eukaryotic cell what would be the micromolar concentration of this protein be in the cytosol

Proteins are thermodynamically unstable molecules since the Delta G of hydrolysis is quite negative. However, most proteins are not degraded unless they come into contact with proteases in cells. What is the reasoning for this paradox? The reaction is endergonic and will not proceed without energy. There is very little water inside cells to react with protein molecules. The free energy change doesn't reveal anything about the rate of the reaction. The concentration of proteins are low which allows them to be more stable.