Why is the peptide formation always presented/read from N-terminal to C-terminal?
Q: With a ∆G°´ of -16.7 kJ/mol, the reaction catalyzed by hexokinase is considered to be _____. at equi...
A: Hexokinase is a phosphorylating enzyme that catalyses the transfer of phosphate group from ATP to gl...
Q: adjust blood pH on the order of hours to days. Secretion of outside the kidneys via ion exchanger to...
A: For appropriate physiological functioning, the concentrations of acids and bases in the blood must b...
Q: Which monosaccharide will be produced when sucrose undergoes hydrolysis reaction? O Glucose and arab...
A: Glucose is a monosaccharide and it is a simple sugar that is the most important source ...
Q: What happens when cell division didn’t undergo or complete the Meiosis I and Meiosis II?
A: A process by which cell divide into two or more daughter cells and distributes its genetic material ...
Q: Determine the catalytic power of jack bean urease in catalyzing the hydrolysis of urea given the fol...
A: ENZYMES : - Enzymes are defined as the organic molecules which helps in catalyzing the reaction....
Q: Question 6 options: Cholesterol is a sterol that is commonly found in mammals. Sterols are pre...
A: Cholesterol is a steroid that constitutes of a hydrocarbon tail, four hydrocarbon rings and a hydro...
Q: Arabidopsis Mammal S.c. S. p. RabF1 RabF1, ARA6, associated with putative endosomal compartments. -R...
A: Rab proteins are responsible for intracellular trafficking of various substances between different m...
Q: Consider a peptide with the following amino acid sequence: H2N-ASENHLDGCPYTKSRG-COOH Analyze the p...
A: pKa: The logarithmic of Ka has a negative value, which is represented by the symbol pKa. pH is defin...
Q: Which of the following statements concerning the D- and L- forms of a monosaccharide is incorrect? O...
A: Sterioisomers are recognised by L and D forms in monosaccharides. The D form is dextrorotatory (rig...
Q: Calculate the approximate MW of a protein with 341 amino acid residues and express it ing/mol and i...
A: Given Values: Number of residues in the protein = 341 aa Average molecular weight of an amino acid =...
Q: Ennumerate the essential amino acids and identify the functional groups present in their structures....
A: Aminoacids are the building blocks of proteins that are linked by peptide bond. Aminoacids are class...
Q: The electron transport chain (ETC), or respiratory chain, is linked to proton movement and ATP synt ...
A: Introduction: The electron transport chain is the movement of electrons from NADH and FADH2 to oxyge...
Q: What is the best interpretation from the results?
A: 1. Negative ninhydrin test shows that the sample does not contain free amino acids. 2. Positive xant...
Q: Describe glucose oxidase's substrate, the substrate’s biological relevance, and identify the main in...
A: Glucose oxidase is an oxireductases class of enzyme which catalyzes the oxidation of glucose to hydr...
Q: 5. Treatment of the patients with familial hypercholesterolemia by statins (pravastatin, for instant...
A: Familial hypercholesterolemia is an autosomal dominant condition. It is linked to early cardiovascu...
Q: What would be the pH level for an enzyme, that prefers acidic conditions.
A: The acidity or basicity of water is determined by its pH. The scale runs from 0 to 14, with 7 denoti...
Q: 6. Amino acid alanine containing NE isotope in a-amino group was administrated to mouse with food. I...
A: The use of radioactive labelling of particular atoms have often been used to determine metabolic pat...
Q: Which of the following is not a helix destabilizer? O Adjacent amino acid residues with big, hydroph...
A: A helix is a protein secondary structure that is defined as the regular arrangement of nearby residu...
Q: CH3 CH2-CH,-CH2 CH2-CH,CH2-CH2-CH2 CH2-CH2 ĉ-SCOA
A: Beta oxidation is the process by which long chain acyl CoA are broken down to acetyl CoA. Each round...
Q: Amount of water added (mL) Amount of Stock Solution (mL) Final Concentration A Solution 1 0. Solutio...
A: The concentration of unknown solution can be calculated from the formula C1V1= C2V2 Where C1= Concen...
Q: The reaction ATP to ADP + Pi is typically part of a(n) ________ reaction. a) free radical b) oxida...
A: Enzymes mediate six primary kinds of biochemical processes in living systems. These include group tr...
Q: Which of the following DNA pol I activities would be MOST important in the removal of the primer? ...
A: DNA polymerase is the key enzyme for DNA synthesis. DNA polymerase requires a single stranded DNA a...
Q: 1. What does it suggest when the cell has a lot of intricate smooth endoplasmic reticulum? 2. How ...
A: Two types of endoplasmic reticulum are found in the eukaryotic cell- the smooth endoplasmic reticulu...
Q: 8. Explain how to prepare 3 ml of a solution with a concentration of 2ug/5ml from a stock solution o...
A: For the preparation of this solution from a concentrated stock solution the formula V1 x S1 = V2 x ...
Q: When the enzyme is incubated with oxaloacetate, will oxaloacetate be observed?
A: Many amino acid biosynthetic pathways involve transamination reactions. The α-amino group from one ...
Q: Find a protein of your choice, choose a part of it (containing at least 30 amino acid residues), fin...
A: A 60 amino acid long portion of the protein (an enzyme ) trypsin from a species of camel (Camelus dr...
Q: Differentiate fertilized and unfertilized egg of Ascaris. Differentiate male and female worm of Ancy...
A: Introduction: Ascaris lumbricoides is a roundworm of man and it is the largest intestinal nematode p...
Q: Select the two most hydrophobic amino acids. A. Leucine and Isoleucine OB. Arginine and Lysine OC Cy...
A:
Q: Analysis of a peptide antibiotic purified from a strain of Bacillus brevii resulted in the following...
A: Average mol weight of one amino acid is 110D. The peptide is of 1200D. This means that the peptide c...
Q: Rank the degree of sweetness of the sugar solutions. 1 – most sweet; 10 – least sweet
A: Sugar cane or sugar beets are used to make refined sugar, which is extracted from the plants after t...
Q: MULTIPLE CHOICE 1. High density lipoproteins is an example of which kind of protein? A. Regulatory...
A: Proteins are composed of twenty standard amino acids attached together via peptide bonds. These twen...
Q: Explain the mechanisms involved in acid-base balance regulation for patients with chronic obstructiv...
A: Acid-base homeostasis and pH regulation are important for maintaining normal physiology and cell met...
Q: Discuss how carbohydrates can be stored as fat. Please answer precisely, clearly, and directly.
A: Carbohydrates are the primary source of energy for the body, and glucose is the simplest form of car...
Q: 1. Which of the following is the example of defense proteins? A. Dehydrogena B. Myoglobin C. Hemo...
A: Proteins are classified in different ways. The basis for the classification is function, chemical na...
Q: What amino acids are present on the unknown sample based on the results below? Test/s Results Ninhyd...
A: There are several test, which are used to perform in order to identify the specific amino acid in a ...
Q: 11.With the help of the buffer reaction in our body explain in a few sentences how the body fights m...
A: Introduction: pH regulation is a function of buffer systems of the body in combination with the resp...
Q: Glycocongugates are, by definition: Question 26 options: Carbohydrates covalently linked to bi...
A: Carbohydrates are macronutrients that are used to produce energy in metabolic activities. Monosaccha...
Q: NAD+ and FAD are oxidized in the electron transport chain. true false.
A: Electron transport chain is transfer of electrons between protein complexes that creat electro chemi...
Q: Spot the difference between the chemical structures of DNA & RNA and state the said difference in a ...
A: Deoxyribo nucleic acid is abbreviated as DNA and Ribonucleic acid as RNA. They are the molecules tha...
Q: 2. Imagine that you have given blood, but a sample of your red blood cells is accidentally stored in...
A: BLOOD : Blood is a circulating fluid which contains numerous cells , oxygen and suspended in plasma...
Q: The steady-state kinetics of an enzyme has been studied in the absence and presence of an inhibitor ...
A: To study the steady state enzyme kinetics, often enzyme velocity “V” is determined at various substr...
Q: which functional group remains charged at pH of 9. „NH2 H2N COOH
A: The pKa of the ionizable groups on an amino acid determines the net charge of the amino acid. Since ...
Q: II. The most highly sensitive test in viral hepatitis is y-Glutamyl transpeptidase (Y-GT) increased ...
A: Gamma-glutamyl transpeptidase is an enzyme present in the body. GGT test is the diagnostic test that...
Q: Give five examples of Cofactors and Coenzymes and describe each
A: Biochemical reactions such as metabolism of biomolecules requires years to complete without the inte...
Q: What is the correct name of this linear glucose molecule, and how many chiral carbons does it have?
A: Carbohydrates are the basic energy source of organisms. They include glucose, fructose, lactose, and...
Q: Which among the following statements is correct? Group of answer choices Both statements are incor...
A: Chromatography is a technique used for separation of molecules based on the principle of distributio...
Q: Optimal DNA replication requires the coordinated effort of all the following EXCEPT: gyrase si...
A: DNA is a genetic material that is a double stranded structure polymer of nucleotides. DNA replicatio...
Q: In this time of COVID-19 pandemic, a communicable disease caused by Severe Acute Respiratory Syndrom...
A: The coronavirus disease (COVID-19) pandemic, caused by the SARS-CoV-2 virus, which has changed to al...
Q: In the second reaction of the pentose phosphate pathway that generates NADPH, What are the subtrates...
A: The pentose phosphate pathway also called the hexose monophosphate shunt is an alternative pathway f...
Q: 3. Differentiate Enzyme Inhibition by filling the table below: Competitive Non-Competitive Uncompeti...
A: Enzyme inhibition is a process by which the activity of an enzyme is altered. Inhibitors are substan...
Why is the peptide formation always presented/read from N-terminal to C-terminal?
Step by step
Solved in 2 steps
- A. What amino acid sequence is encoded by the codon sequence AUAAUGGUAACGGUU? B. Suppose the codon sequence AGACACUCUAUUAAA has a single base pair mutation to AGACACUCUUUUAAA. If the old protein sequence was Arg-His-Ser-Ile-Lys, what will be the new sequence encoded by the mutant gene?What is the peptide encoded by this mRNA sequence 5’-UCU-GCA- AAU-UAA -GUU-3’?A sample of a peptide of unknown sequence was treated with trypsin; another sample of the same peptide was treated with chymotrypsin. The sequences (N-terminal to C-terminal) of the smaller peptides produced by trypsin digestion were as follows: Trp-Arg-Thr-Gin Ser-Trp-Arg-His-Trp-Ala-Lys Asp-Val-Ala-Ala-Lys Asn-Ser-Asn-Val-Ile-Arg The sequences of the smaller peptides produced by chymotrypsin digestion were as follows: Arg-His-Trp Arg-Thr-Gin Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp Asp-Val-Ala-Ala-Lys-Ser-Trp The original peptide sequence was: Asp-Val-Ala-Ala-Lys-Ser-Trp-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-His-Trp-Arg-Thr-Gin Asp-Val-Ala-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-Thr-Gin-Ser-Trp-Arg-His-Trp-Ala-Lys Trp-Arg-Thr-Gin-Asn-Ser-Asn-Val-Ile-Arg-Ser-Trp-Arg-His-Trp-Ala-Lys-Asp-Val-Ala-Ala-Lys Arg-His-Trp-Arg-Thr-Gln-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Asp-Val-Ala-Ala-Lys-Ser-Trp Asp-Val-Ala-Ala-Lys-Ser-Trp-Arg-His-Trp-Ala-Lys-Asn-Ser-Asn-Val-Ile-Arg-Trp-Arg-Thr-Gin…
- Given the sequence below, (A) What is the transcript (MRNA) sequence? (B) What is the amino acid sequence of the translated peptide? Rather than using abbreviations, write out the entire name of each of the amino acids in your peptide, so you do not risk using the wrong abbreviation and, therefore, providing the wrong sequence. 5' - ATG CTT GTA ATA CCG TGA - 3'A sample of a peptide of unknown sequence was treated with trypsin; another sample of the same peptide was treated with chymotrypsin. The sequences (N-terminal to C-terminal) of the smaller peptides produced by trypsin digestion were as follows: Ala Ser Glu-Met-AspLys Cys-His Ile His-Arg Thr-Trp Ala Ile-Phe-Asn-Arg Trp Cys–Cys–Gln The sequences of the smaller peptides produced by chymotrypsin digestion were as follows: Glu-Met-Asp Lys-Trp Asn-ArgAla Ser Cys-His-Ile-His-Arg-Thr-Trp Ala Ile-Phe Cys-Cys-Gin The original peptide sequence was:These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
- A sample of a peptide of unknown sequencewas treated with trypsin; another sample of the same peptide wastreated with chymotrypsin. The sequences (N-terminal to C-terminal)of the smaller peptides produced by trypsin digestion were as follows:What is the receptor for the targeting sequence?Dystrophin is mutated in the disease, causing a codon to change from GGA to UGA. What is the consequence of this change? (
- A sample of an unknown peptide was divided into two aliquots. One aliquot was treated with trypsin; the other was treated with cyanogen bromide. Given the following sequences (N-terminal to C- terminal) of the resulting fragments, deduce the sequence of the original peptide. Trypsin treatment Asn-Thr-Trp-Met-lle-Lys Gly-Tyr-Met-Gln-Phe Val-Leu-Gly-Met-Ser-Arg Cyanogen bromide treatment Gln-Phe Val-Leu-Gly-Met lle-Lys-Gly-Tyr-Met Ser-Arg-Asn-Thr-Trp-MetShown is part of the coding strand of the HBB gene involved in sickle cell disease. What will be the effect on the resulting peptide of a deletion of the two nucleotides shown in bold/underline? 5' CTG ACT CCT GAG GAC 3' a) A change from glutamic acid to valine will occur b) The deletion will not result in a change to the polypeptide c) A nonsense mutation will occur d) The polypeptide will be missing one amino acid, but the reading frame will be preserved5'GGT ACG TTG GGG CTC CAT3' This sequence is transcribed and translated. Write the resulting amino acid sequence using the 3 letter code. Write the answer in a all capital letters. Leave a space between the amino acids. Do not write 5' and 3'. 5'GGT ACG TTG GGG CTC CAT3' This sequence is transcribed and translated. If the G in Bold changes to a T, then the result will be A) A nonsense mutation B) A frameshift mutation C) A silent substitution D) A missense mutation 5'GGT ACG TTG GGG CTC CAT3' This sequence is transcribed and translated. If the G in Bold changes to a A, then the result will be A) A nonsenese mutation B) A frameshift mutation C) A silent substitution D) A missense mutation