What is the function of each of the RNAs below in translation? 1. mRNA 2. tRNA 3. rRNA mRNA tRNA rRNA [Choose ] [Choose ] Attaches to amino acids and takes them to the ribosome Matches up tRNA and mRNA, then bonds amino acids together Copies gene from DNA and takes it to the ribosome [Choose ]
Q: Globally, terrestrial protected areas tend to be located on the least; low least; high most; low…
A: The makeup of communities and broad-scale biodiversity gradients are significantly influenced by…
Q: Which of the following features are shared by photosynthesis and aerobic oxidation? O Production of…
A: Most life on Earth depends on photosynthesis and cellular respiration, two metabolic processes. Each…
Q: Explain why underconsumption of the fruit or vegetable category can be a concern for your…
A: Introduction: A diet refers to the types and amounts of food that a person eats on a regular basis.…
Q: The rate of photosynthesis in an aquatic plant can be determined by the number of bubbles released…
A: Introduction Plants, algae, and some bacteria transform solar energy into chemical energy in the…
Q: Discuss a scenario where none of these vaccines are available and how it would have impacted the…
A: A vaccine is a substance that stimulates the immune system of the body to recognize and combat…
Q: Give typing answer with explanation and conclusion 1) What is the purpose of the CD4 and CD8…
A: CD4 and CD8 are cell surface proteins found on T cells in the immune system. CD4 is primarily found…
Q: What is the size of the current that flows through ENaC for both vectors? Control: 97mA.cm2…
A: CFTR stands for Cystic Fibrosis Transmembrane Conductance Regulator. It is a protein that is…
Q: VIII. Vestibulococt nerve XII. Hypoglossal nerve Cranial nerve diagram Select the cranial nerves…
A: The question is asking to identify the cranial nerves that are primarily responsible for motor…
Q: Put in the correct order major stages in light reactions Photolysis in Photosystem II NADP+ reduced…
A: The photolysis process, also referred to as the light reaction, occurs when light is present.…
Q: Question 8 Which of the following are true about cell signaling? (select all that apply) ✔ the same…
A: Cell signaling refers to the process by which cells communicate with each other to coordinate their…
Q: 1. In dogs, brown or black coat color is determined by a single autosomal gene with brown (b) being…
A: Introduction: Genetic biology is a field of biology that focuses on the study of genes, genetic…
Q: phosphofructokinase is an allosteric enzyme that catalyzes the conversion of fructose 6-phosphate to…
A: In mammals, the allosteric regulation of phosphofructokinase is primarily achieved through the…
Q: You decide to do a series of experiments to determine where the toxin has its effect. You accomplish…
A: The correct option is B. Either the alpha motor neurons ability to conduct action potentials or the…
Q: 4. which are functions of water in the body?
A: Water is a vital component in many chemical reactions that take place within the body, including…
Q: We got you something. 0₂ I love it! I'm going to share it with EVERYONE! Other Explain what is going…
A: Introduction Gas exchange is the process by which oxygen (O2) and carbon dioxide (CO2) are exchanged…
Q: Cats should eat more than once a day. Mention two research articles related to this topic.
A: Introduction: Cats are a domesticated species of small carnivorous mammals that are popular pets all…
Q: Identify an accurate statement about antimicrobial drugs. Absorption of daptomycin…
A: Antimicrobial drugs are defined as natural or synthetic chemical substances that are used to prevent…
Q: Which of the following represents the best examples of homologous structures (i.e. results of shared…
A: Structures which have a common basic structure but perform different functions are called homologous…
Q: Given what you have learned from the first experiment, you prepare the other leg for a fresh…
A: Curare," which is a class of drugs that block nicotinic acetylcholine receptors (nAChRs) located on…
Q: 1.knowing the Control is 3.11 x 10-11 moles.cm-2.sec-1 and the is CFTR-CRISPR: 3.11 x 10-10…
A: In this question, we are presented with an experimental study that used CRISPR-CAS9 to correct the…
Q: Give typing answer with explanation and conclusion…
A: The production of RNA from DNA is known as translation that occurs within the nucleus of eukaryotic…
Q: A patient with suspected Addison's disease reports experiencing a loss of libido in recent months.
A: Addison's Disease: Primary adrenal insufficiency, another name for Addison's disease, is a rare…
Q: The enzyme phosphofructokinase-1 (PFK-1) catalyzes the reaction F6P+ ATP-> F1,6BP + ADP during…
A: Introduction Allosteric inhibition is a type of enzyme regulation where a molecule binds to a…
Q: T/F: This reaction probably produces NADH in a cell O True CH2OH -ОН O False Н но-н Н Н -ОН -OH…
A: Few important points : Nucleic acids and proteins are informational biomolecules. Amino acids will…
Q: Give typing answer with explanation and conclusion Why 70% Alcohol is better than 100% Alcohol (as…
A: Introduction :- Alcohol is widely used as an antiseptic due to its ability to kill or inhibit the…
Q: Would you donate a kidney to a friend of family member whose kidneys were failing? Would you…
A: Living kidney donation is one of the best options for the people needing new kidney. To donate to a…
Q: 5. Oxygen uptake rates (OUR) and oxygen transfer rates (OTR) were determined in a fermenter with air…
A: A. To determine the maximum oxygen transfer rate (OTR), we need to calculate the slope of the…
Q: knowing that the Control is 6.22 x 10-20 moles.channel-2sec-1 and CFTR-CRISPR: 3.84x 10-20…
A: Immunostaining using Quantum Dot fluorescence is a technique that combines the specificity of…
Q: The typical intake and output of water are about _____. Multiple Choice 1500 ml/day 2500…
A: The typical intake and output of water can vary depending on several factors such as age, sex, body…
Q: Match each of the Movement toward or away from something Passing DNA onto offspring Organisms…
A: Question 1: The question is asking about the organization of the layers of cells that make up the…
Q: Protein Rab Tethering Protein V-SNARE T-SNARE LOCATION? What does it bind? Needed for recognition or…
A: Introduction : Membrane trafficking involvew the process in which biochemical signal molecules are…
Q: flowers bed indb #.N.P.K pieda outer layer germinal ground tissue: ● ● Aggregates of cells -…
A: Tissues are aggregates of cells. These cluster of cells work together to perform a specific…
Q: pH 3.5 4.5 5.5 6.5 7.5 8.5 Absorbance 0.098 0.027 0.068 0.028 0.032 0.054…
A: To calculate the amount of soluble protein (in grams) in the soy flour extract, we need to use the…
Q: b. A hamster has a heart rate of about 634 beats per minute. About how long will a hamster live?
A: The heart rate of hamster is 634 beats per minute. The life span and the heart rate of mammals are…
Q: I would like to know where is this information from, that way I can make citations id it is…
A: A simple , safe and effective way to protect ourselves against harmful disease before come into…
Q: The present drug of choice to induce abortion during the second trimester is _____. Multiple Choice…
A: Introduction When a pregnancy is aborted, it means that the foetus cannot survive outside of the…
Q: How would you calculate BPM (beats per minute) manually to check your results?
A: Introduction BPM, or beats per minute, is a unit of measurement used to describe the tempo or speed…
Q: Olivia has just been diagnosed with sepsis caused by Pseudomonas aeruginosa. During her treatment,…
A: Pseudomonas aeruginosa is a rod-shaped, Gram-negative bacterium belonging to the family…
Q: How have opiate analgesics been reformulated to reduce their abuse potential?
A: Introduction :- Opiate analgesics are a class of medications that are used to treat pain. They work…
Q: "In looking at nature, never forget that every single organic being around us may be said to be…
A: Charles Darwin (1809-1882) was an English naturalist and biologist who is famous for his…
Q: add on and summarize All education starts at home. A school is bound within limits when it comes to…
A: Note:- Sorry, as per the honor code we can not share personal opinions, however, we will provide…
Q: You are working as a Research Scientist I at Albany Molecular Research. For one of your bacterial…
A: To determine the mass of a substance, we must first determine its molecular weight and molarity.…
Q: What is the taxonomic name for the superclass (of bony fish) that reflects the presence of a bony…
A: Introduction All bony fish, which are identified by possessing a bone skeleton, fall within the…
Q: Question 5 ( When patient tissues are transfected with viruses carrying a needed, normal human gene,…
A: Sometimes a virus is used to deliver the required gene into the tissues. The required or foreign…
Q: In amphibians, cutaneous gas exchange is particularly important, especially in some species of…
A: Salamanders are lungless amphibians which primarily rely on cutaneous respiration. Cutaneous…
Q: Explain in simple terms and defin
A: ANSWER) Primary plant growth occurs through the rapid cell division occuring in the apical meristems…
Q: Provide five examples of viruses that are implicated in cancer development in humans, and which…
A: Some viruses can cause cancer by inserting their genetic material into the host cell's DNA, which…
Q: b. How does the immune system work to protect the body from pathogens, and what are some common…
A: Immunity refers to the ability of the body to defend itself against infectious agents and other…
Q: What additional experiments could you do with chicken eggs to test the properties of membranes…
A: There are several additional experiments that can be done with chicken eggs to test the properties…
Q: Give typing answer with explanation and conclusion 1) What is selected to grow on MacC, MSA, and…
A: Agar media is a type of culture medium used in microbiology to grow and maintain bacterial and…
![What is the function of each of the RNAs below in translation?
1. mRNA
2. tRNA
3. rRNA
mRNA
tRNA
rRNA
[Choose ]
Choose ]
Attaches to amino acids and takes them to the ribosome
Matches up tRNA and mRNA, then bonds amino acids together
Copies gene from DNA and takes it to the ribosome
[Choose](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2F2d41f1b0-76e3-4932-ae17-21306a482a1c%2F5bae1340-f438-4ad4-b06c-9bc8eea5d8de%2Fpl18elvq_processed.jpeg&w=3840&q=75)
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Mutated DNA Sequence #2 T A C G A C C T T G G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________QUESTION: Write the BRACKETED and INDENTED dichotomous keyDNA GAAGGGACAATACTTTCTTAACACTTG MRNA Amino Acid Sequence 1. Which kind of protein molecule did this gene make? 2. How does this protein help the body maintain homeostasis? Conclusion Questions: 1. Examine the protein you created. If the DNA strand that you started with had a change in it (A changed to G), what would happen to the protein made?
- Mutated DNA Sequence #3 T A C A C C T T A G C G A C G A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ________________________________ Mutated DNA Sequence #4 T A C A C C T T G G C G A C T A C T … What’s the mRNA sequence? (Circle the change) What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? ______________________________134 LABORATORY Size of the Cell U22T RAJUBAV RO OJA Shape of the Nucleus 916 91032 Degree of Chromatin Condensation Presence or Absence of Nucleoli Cytoplasmic Staining Blood Cells Presence of Cytoplasmic Granules Cytologic/Histologie 18: or cellule Bone Marrow Cells of the develo eveloping cells noil Identi 010Question: Define transcription and
- QUESTION FROM GENETICS।। THANKSposition position (5' end) position (3' end) UUU Phe - F UUC Phe UAU Tyr Y. UAC Tyr UAA Stop UGU Cys UGC Cys UGA Stop UGG Trp UCU Ser UCC Ser U UUA Leu UUG Leu UCA Ser UCG Ser UAG Stop W 輔 CAU His CGU Arg CGC Arg CGA Arg CGG Arg CUU Leu CCU Pro CUC Leu CCC Pro P. CCA Pro CÁC His CỦA Leu CAA Gln CUG Leu CCG Pro CAG GIn AUU lle ACU Thr AAU Asn AGU Ser AUC lle ACC Thr -T ACA Thr AAC Asn_ AGC Ser AGA Arg AGG Arg A AUA lle AAA Lys EK AAG Lys AUG Met ACG Thr GUU Val GGU Gly GGC Gly GGA Gly GGG Gly GAU Asp D GAC Asp GCU Ala GUC Val -V GUA Val GCC Ala GCA Ala GCG Ala G - A GAA Glu FE GAG Glu GUG Val Nonpolar Polar Basic Acidic Stop codon Table 4.1 Biology: How Life Works, Third Edition © 2019 W. H. Freeman and Company Consider the DNA sequence–3'-CACTGGTAGCGA–5', • What is the sequence of the messenger RNA sequence that is transcribed from this DNA sequence? (Indicate the 5' and 3' ends of the RNA molecule.) • Consult the genetic code that is shown above. What is the amino acid sequence of the…Question:- 5. What happens when p53 senses that DNA damage is beyond repair? Why is thisadvantageous?
- Please answer fast Given the following enzymes, fill up the table. You may repeat answers in each column. Replication Transcription Translation Answer Answer Answer Enzymes: DNA ligase DNA polymerase Helicase Peptidyl transferase SSBIII. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…Directions: Given the DNA strand below. Decode the hidden message in the proteins that will be produce in protein synthesis of the given DNA strand. Identify the (1) complimentary DNA strand, (2) mRNA, (3) tRNA, (4) amino acid sequence, and (5) protein. Use the 1-letter symbol of the amino acids to produced to decode the message.