The following diagram depicts the elements at the: Ac TTC g99 Eca cgcc tataan ATT BRE TATA box Inr DPE (TBP) TFIIB TEIID Promoter Enhancer O transcribed gene O Silencer
Q: A pre-initation complex (PIC) is required for transcription to begin. State which TFII protein has…
A: The pre-initiation complex forms at the core promoter to initiate the transcription of the…
Q: e table below with the word that matches the definition in the right column. regulatory proteins…
A: Step 1 - 1- regulatory proteins that speed up transcription by helping RNA polymerase bind to…
Q: Imagine that mutations occurred in one of the inverted repeat sequences within the rho-independent…
A: Transcription is the primary step in the process of gene expression. The process of the conversion…
Q: For each of the following types of gene regulation, indicate whether it occurs in eukaryotes only,…
A: a. Differential splicing: It is the process by which certain exons are skipped during splicing to…
Q: Which of the following IS a trans acting factor? Shine Dalgarno sequence O Oric Lac Operator O TATA…
A: The trans-acting elements are record factors or other DNA-restricting proteins which perceive and…
Q: The TATA box is located at which region of the promoter? O Position 0 O Position -35 O Position -10…
A: A TATA box is a DNA sequence that tells how to read and decode a genetic sequence. It's a form of…
Q: Which one of the following genes encodes a transcription factor
A: Transcription factor or TF is also referred to as sequence-specific DNA-binding factor in molecular…
Q: The eukaryotic transcription factor that exhibits a sequence specificity for the TATA box is: A)…
A: Transcription is the first step in the gene expression which transfers the genetic information…
Q: Select the descriptions that are specific for a general transcription factor Select 2 correct…
A: Correct options are: Option A i.e. transcription factor can act to repress or activate a certain…
Q: Which one is NOT a function of the Signal Recognition Particle (SRP) in protein targeting? 1.…
A: Every cell give a set of compartments meant for protein localization. The transport systems acting…
Q: TBP stands for?a) TATA box polymeraseb) TATA-box binding proteinc) Transcription associated factord)…
A: TBP is a type of a protein that helps in the process of transcription. Transcription is the process…
Q: on The TATA box in the promoter region of prokaryotic cells helps the RNA polymerase to bind…
A: True.
Q: Which of the following is false when the genes of the Lac operon are being tran- scribed in high…
A: Lac operon is a set of genes used by E.coli to metabolize lactose when glucose is not available for…
Q: Which of the following mechanisms may be involved when PRC1complexes silence gene expression?a. The…
A: The process of genic expression is used to direct the assembled protein molecule with the encoded…
Q: When present, the TATA, CAAT and GC boxes are typically found within 100 - 150 bp upstream from the…
A: The TATA box is a conserved nucleotide sequence located around 25-30 base pairs upstream of the…
Q: . Which of the following is an example of post-transcriptional gene repression?a. The amount of RNA…
A: Post-transcriptional gene repression means the expression of the gene in the form of protein is…
Q: Define and describe the roles of the following in transcription: a. transcription factors b. RNA…
A: Transcription is the process where the information in a DNA strand is copied and interpreted into a…
Q: Which of these molecules is produced by a regulatory gene? O promoter O operator O operon O…
A: a gene that controls the creation of a protein (such as a genetic repressor) that limits the rate of…
Q: Define the following terms:a. Crabtree effectb. transcription factorc. response elementd. insuline.…
A: The Crabtree Effect occurs in metabolically adapted cell lines are grown in anaerobic conditions…
Q: The Assembly of Class III Transcription Initiation Complexes consists of TATA-binding protein (TBP)…
A: Transcription initiation complex It is the complex of transcription factors and RNA polymerase…
Q: peptide is elongated in the :
A: In this question, we have to answer the peptide elongated at which site.
Q: All may be RNA polymerase Il promoter constituents EXCEPT: (A a TATA box upstream the transcription…
A: * promoter is sequence of DNA where proteins binds initiate transcription of RNA from DNA downstream…
Q: Assembly of transcription initiation complexes is mainly controlled by
A: Assembly of transcription initiation complex is a process of bringing together all the components…
Q: Select the descriptions that are specific for a regulatory transcription factor (RTF) Select 4…
A: Genes are the fundamental unit of heredity. They store genetic information in the form of DNA, which…
Q: Which of the following is not involved in the post transcriptional processing of t-RNA?a) Base…
A: Full name is tRNA is transfer RNA. It supplies amino acids to ribosome at the time of protein…
Q: Suppose MYC regulates gene X by recruiting DNA methyltransferases (DNMTS). Which of the following…
A: cis regulatory elements are regions of non coding DNA which regulate transcription of neighbouring…
Q: Usually found in prokaryotes, regulatory sequences lying adjacent to the DNA being transcribed are…
A: In prokaryotes, the process of transcription and translation occur simultaneously due to the lack of…
Q: Suppose multiple mutations occur in the U1 snRNA. Which step mechanism would be directly impaired? O…
A: The processing of mRNA (messenger ribonucleic acid) includes the addition of a 5’ cap composed of…
Q: Proteins that increase the efficiency of RNA polymerase binding to the promoter are called O…
A: Gene expression is increased with binding of RNA polymerase to gene promoter and then initiate…
Q: This diagram shows a double-stranded section of DNA. The arrow indicates location and strand of the…
A: Transcription is the process of formation of mRNA using DNA as template. This is possible with the…
Q: The following diagram depicts the elements at the: Ba cgcc tataan 999 AC ATT BRE TATA box Inr DPE…
A: The diagram depicts elements at the Promoter :
Q: The TATA box binding protein binds to the TATA box. What is the DNA sequence of this region of the…
A: TATA box is a DNA sequence.
Q: which of the following is true regarding SLI? a. Contains the TATA binding protein b. Binds first…
A: SL1 or Selective factor 1 is a transcription factor. SL1 binds to the promoter of the gene. RNA…
Q: ose d CAP lac I repressor allolactose CAMP C RNA Pol promoter operator +1 lac Z lac Y lac A DNA
A: E.coli's Lac operon contains the genes required for the lactose metabolism. Genes involved in the…
Q: Promoters always contain a
A:
Q: Which RNA conformation favors transcription—the form with the antiterminator stem-loop or the form…
A: Genes are basic physical and functional unit of heredity. It is a part of DNA that has instruction…
Q: dỗ the lác, trp repressor and CAP protein have in common? O They have a Helix-Turn-Helix Motif O…
A: Bacteria employ polycistronic expression of genes. The genes are arranged as a unit called an…
Q: Match the parts of the Lac operon with the correct name. A C DNA MRNA RNA polymerase
A:
Q: glucose absent lactose present ituations the condition of each of these components (yes or no)…
A: Answer: There are two types of genes in the lac operon: structural genes and regulatory genes.…
Q: Which one of the following is not associated with transcription? * O sigma factor O hairpin loop…
A: Transcription is a process of making a RNA copy from sequence of DNA. Transcription is the process…
Q: Matching type Choices are in the picture 11. regulating elements in the operon 12. ribosome…
A: Transcription is the process by which the information in a strand of DNA is copied into a new…
Q: The binding of an enhancer O stimulates transcription of a specific gene. O stimulates splicing of a…
A: The binding of an enchancer stimulates transcription of a specific gene , such as enchancer sequence…
Q: General transcription factors O act at every gene for a given RNA pol O act only at specific genes…
A: General transcription factors are the proteins that help to position RNA polymerase II correctly on…
Q: Which of the following cis regulatory elements are present in the pre-MRNA sequence? SRs hnRNPs ESES…
A: RNA editing and splicing are the two major techniques that dynamically regulate human transcriptome…
Q: Indicate whether each of the following events occurs when tryptophan is high or when tryptophan is…
A: In some operons like tryptophan operon, transcription starts from transcription start site, but get…
Q: 85 __________ is the sequence motif located downstream from the Inr core promoter motif. A. BRE b.…
A: 85 __________ is the sequence motif located downstream from the Inr core promoter motif. A. BRE b.…
Q: DNA sequence that stimulates transcription are referred to as O activator O silencer O enhancer O…
A: Transcription is the preliminary degree in gene expression, whilst facts from a gene is used to…
Q: The basal transcription factor that recognizes the TATA, Inr, MTE, and DPE core promoter elements is…
A: Since you have asked multiple question, we will solve the first question for you. If you want any…
Trending now
This is a popular solution!
Step by step
Solved in 3 steps
- These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIVWhich is the odd one out ? For the rest, explain the concept/process/technique they are involved with. TFIIA TFIID TATA Box TFIIB CAG/CAAThe following is a portion of a protein: met-trp-tyr-arg-gly-pro-thr-Various mutant forms of this protein have been recovered. Using the normal and mutant sequences, determine the DNA and mRNA sequences that code for this portion of the protein, and explain each of the mutations. a. met-trp- b. met-cys-ile-val-val-leu-gln- c. met-trp-tyr-arg-ser-pro-thr- d. met-trp-tyr-arg-gly-ala-val-ile-ser-pro-thr-
- Which of the follow general transcription factors contains the protein TBP and binds to TATA box promoters first? Group of answer choices TFIID TFIIB TFIIA TFIIFCTA GCC CTC CGT TAC TAG TTA CCT ACT TAT TCA ATT TTG TAA ACG CTC ATC CGA ACC CGC TTT TAA TTG CCC ACT TAG TCG ATT ACC CGT TTA TGT TAA TTA CCT ATC 1. Build the mRNA molecule matching the RNA nucleotides to the DNA nucleotides properly letter by letter. (assume that the mRNA is bacterial there are not intros to cut out) 2. Figure out the tRNA triplet (codons) that would fit the mRNA triplets. (letter by letter) 3. Look up for each tRNA codon and find the corresponding symbol and amino acid abbreviations. The symbols should spell out a meaningful English message.e In the figure below, what is represented by the line labeled A? TFIIB recognition element DNA in m 3' G/CGICGIC CGCC -35 TATA box TATAAA -25 A Initiator element YYAN TAYY +1 Downstream core promoter element RGATCGTG +30
- CTA GCC CTC CGT TAC TAG TTA CCT ACT TAT TCA ATT TTG TAA ACG CTC ATC CGA ACC CGC TTT TAA TTG CCC ACT TAG TCG ATT ACC CGT TTA TGT TAA TTA CCT ATC 1. Build the mRNA molecule matching the RNA nucleotides to the DNA nucleotides properly letter by letter. (assume that the mRNA is bacterial there are not intros to cut out)TAN TTGC IGGAG Nanog regulatory sequence Given this interaction map which DNA sequence would the transcription factor most likely bind to? CAAGGAG ATTAACG TAATTGG TAATTGCWhat would happen if you changed the anticodon in the Tryptophan tRNA from ACC to AAC? First letter U C A G U UUU Phe UUC Phe UUA Leu UUG Leu CỰU Leu CUC Leu CUA Leu CUG Leu AUU lle AUC lle AUA lle AUG Met GUU Val GUC Val GUA Val GUG Val Second letter C A UCU Ser UCC Ser UCA Ser UCG Ser CCU Pro CCC Pro CCA Pro CCG Pro ACU Thr ACC Thr ACA Thr ACG Thr GCU Ala GCC Ala GCA Ala GCG Ala UAU Tyr UAC Tyr UAA Stop UAG Stop CAU His CAC His CAA Gln CAG Gln AAU Asn AAC Asn AAA Lys AAG Lys GAU Asp GAC Asp GAA Glu GAG Glu G UGU Cys UGC Cys UGA Stop UGG Trp CGU Arg CGC Arg CGA Arg CGG Arg AGU Ser AGC Ser AGA Arg AGG Arg GGU Gly GGC Gly GGA Gly GGG Gly O Tryptophan would be incorporated into peptides where leucine normally goes Tryptophan would be incorporated into peptides where it normally goes ○ Leucine would be incorporated into peptides where Tryptophan normally goes O Histidine would be incorporated into peptides where Leucine normally goes U C A G U C A G U C A G U C A G Third letter
- The Assembly of Class III Transcription Initiation Complexes consists of TATA-binding protein (TBP) TBP-associated factor (TAF) Both NoneDesign 6 bp primers to amplify the region of this sequence that is highlighted in yellow. attatatttt atattatata ctctgggctc agagcagccc 40 41 atattatata tatatatttt aaaatattat aaatttattt 80 81 cagtcacgcg tcctgatgac attatatttt ataatttttt 120 121 ttttattttt attatatttt aaaatattat aaatttattt 160 161 aaaatattat tatatattta aaatttattt attataaaat 200 201 aaaatattat ttttattttt gagatcagga cggctgcatg 240 Forward primer Reverse primerw/opCulGACU GAC UC 4C According to the Genetic Code Sheet below, which of the following amino acid sequences corresponds to this MRNA strand? CỤC AAG UGC UUC PHE GLU ASP SER ALA TYR U A STOP A GU VAL U CIS U U G A STOP IG TRP ARG AC U LEU SER UG PRO ASN HIS THE GLN MET ILE ARG O a lys-leu-cys-phe O b glu-cys-pro-phe leu-lys-cys-phe O d leu-glu-leu-val U...pdf