give the structure of post Squence 5'-AGCTA-3! Complete and give the Sturaute Structure. at Complementry and and this squence of the DMA sequence abue.
Q: 8. In the scientific completion against fixism, what are the main arguments that favor evolutionism?
A: Introduction Evolution is the process of a species' features changing over numerous generations…
Q: 1. Determine what is the Cross section? What's under the numbers? 3 5 1 6 8
A: This is cross section of Dicot root.
Q: Which of the following is true of proto-oncogenes? They tend to be genes functioning in highly…
A: The answer is ''they tend to be genes functioning in highly differentiated cells''.
Q: Which statement accurately complete the following sentence: “If selection favors a new allele within…
A: "Evolution" is responsible for species variety. The evolution of various species in an area causes a…
Q: Positive sample negative sample 5. Unbound labeled antibody is washed away and a colorimetric…
A: ELISA - Enzyme linked immuno sorbant assay The ELISA technique is used to detect the presence of…
Q: 6. Why is it necessary for the DNA to replicate prior to cell division? A. so that each daughter…
A: 6. B. so that each daughter cell will have a complete copy of genetic material. 7. Purple = PP,…
Q: Can you do the first part
A:
Q: his homework question I have been having difficulty figuring out what the atomic mass is for Gi + ^2…
A: These two elements are termed isotopes of each other when they have the same number of protons,…
Q: Create a dichotomous key diagram for Human Pig Bird Giant panda Koala
A: Dichotomous key It is a method of determining specimens on the basis of contrasting statements that…
Q: Class: Hydrozoa Genus: Obelia Common Name: Coenosarc
A:
Q: Match the following statements with the appropriate term The terms are: a.Genetic polymorphism b.…
A: Introduction Evolution is the process of a species' features changing over numerous generations…
Q: Question in Image
A: nervous system A nervous system is a collection of nerves that work together in the transmittance of…
Q: Is there any other steps or is this the full solution? im still a bit confused.
A: Punnette square is the tabular representation of different phenotypes and genotypes in a cross.…
Q: What role does oxygen play in the electron transport chain?
A: Introduction :- An electron transport chain is a collection of protein complexes and other molecules…
Q: WHAT ELSE CAN I ADD TO THIS? Organisms are able to survive and function because of buffers.…
A: The molecules which are capable to donate protons are generally known as acid and those which are…
Q: Discuss three differences between antigen and antibodies Explain the structure of the antibody…
A: Antigens are nonself molecules that enter into the body. Antibodies are gamma globulin and they…
Q: Q7. Haemophiliacs possess a non-functional form of the gene responsible for the production of blood…
A: Answer :- Dominant allele = H Recessive allele = h Supercript on X are xH and xh xH =Dominant xh=…
Q: Which of the following combinations describes the electron in the modern model of an atom? Onegative…
A: Atom It is a particle of matter that constitutes the nucleus and the orbits. The nucleus contains…
Q: These structures allow bacteria to have reserve deposits of lipids or gasses. O a) inclusions Ob)…
A: Bacteria are small single-celled organisms. Bacteria are found almost everywhere and some e species…
Q: How does the scientific meaning of “theory” differ from the common vernacular meaning?
A: Science is derived from the latin word scientia, which means "to know". Science can't be proved by…
Q: A microbe cannot grow without using enzymes. Explain why bacteria are limited to growth within a…
A: Introduction Bacteria are the smallest microscopic unicellular organisms on the earth. Bacteria can…
Q: For each phenotype below, list the genotypes (remember to use the letter of the dominant trait)…
A: The term "phenotype" refers to an organism's observable physical properties, such as its appearance,…
Q: Replacing simple carbohydrates with complex carbs typically results in a diet that is higher in…
A: Digestion is the breakdown of large insoluble food molecules into small water-soluble food molecules…
Q: receptor-mediated endocytosis begins with the binding of specific molecules to their receptors on…
A: In case of receptor mediated endocytosis , molecules bind with their receptor present on…
Q: Gluconeogenesis i
A: Glucose is the main source of fuel for our cells. When the body doesn't need to use the glucose for…
Q: Which of the following is NOT found in a prokaryotic genome? A. tRNA genes B. Operons C.…
A: There are 2 types of living cells present on earth, prokaryotic cells and eukaryotic cells.…
Q: extrocellular matrix
A: The space inside of the cell is called the intracellular space and the space between the cells is…
Q: Lamarck suggested that organisms arise spontaneously and then become increasingly more complex. With…
A: Lamarck's theory was based on a principle of physical changes in an organism such as greater…
Q: When activated extracellularly, G protein-coupled receptors (GPCRs) initiate which of the following?…
A: GPCRs are a large family of cell surface receptors that respond to a variety of external signals.
Q: A K-selected species is likely to exhibit O a type I survivorship curve and a short generation time.…
A: Many elements of the species differ, including the likelihood of dying at any point in their lives.…
Q: What are the reasons why the products based on onion and garlic that use against COVID-19 can be…
A: Generally, intake of onions could help build immunity to protect against infections. Onions are…
Q: A device called a hemocytometer is used to measure the amount of hemoglobin present. Red blood cells…
A: Cancer is a fatal disease that has both physical and mental consequences for a person. Cancer can…
Q: Partial blockage in the drainage system causes pressure inside the eye, which affects vision and…
A: Introduction The visual system includes the eyes. They give living organisms vision, the ability to…
Q: . Illustrate the different types of Microtome. a. Identify its uses b. Identify its different parts…
A: In biology, microscopic studies are important to study the structure and organisation of different…
Q: Which among the types of microscope is the most important?
A: A microscope is a tool that lets in you to observe tiny things like cells and component of the cell,…
Q: Use physical traits seen in your animal to create a: 1 trait Punnett Square 2 trait Punnett square…
A: PUNNETT SQUARE_ The Punnett square is a tabular summary of possible combinations of maternal…
Q: Why do eating salty foods make you thirsty? Why do eating salty foods make you temporarily gain…
A: Introduction The human body requires a small amount of sodium to maintain the proper balance of…
Q: The primary motor cortex is located in the... occipital lobe temporal lobe parietal lobe frontal…
A: Primary motor cortex locwted at the rear of frontal lobe of the brain. It is associated with…
Q: List three ways that enzymes can become denatured and lose their function.
A: Enzymes can denature and lose their functions by following ways - Increase of temperature…
Q: Yoghurt starter culture is a mixed population of S. thermophilus and L. bulgaricus, both competing…
A: The living beings on this planet have been broadly divided into two categories - Plants and Animals.…
Q: 2. Label the structures in the digestive system of the frog. Write all labels on the spaces…
A: Introduction A frog's digestive system starts from the mouth and ends at the cloaca. After food…
Q: Guide question 1. What can you infer from symbols in the illustration?
A: Note: As Per Guidelines, We Can Answer One Question At A Time. Ask Again To get rest answers.…
Q: Which of the following is only composed of exergonic reactions? O Metabolism Catalysts Anabolism…
A:
Q: Which is a disaccharide? O glucose O fructose O sucrose cellulose
A: Monosaccharides are the simplest carbohydrates; and are termed simple sugars. A disaccharide is the…
Q: Blood typing in human depends on three alleles .The IA and IB alleles are codominant and and the…
A: Blood groups are determined by three alleles. These alleles involve IA, IB, and i. i allele is…
Q: Think about the important functions of telomeres. Now, imagine a scenario in which a mutant…
A: Introduction Telomeres are repeating sequences that protect the natural ends of linear eukaryotic…
Q: How does Lamarck'd idea of "use and disuse" differ from Darwin's idea, which was later called…
A: Species diversity is a measure of biological variety seen in a certain ecological community,…
Q: 6. Assume that you are working at a biotechnology company and you are assigned to a project in which…
A: Protein purification is a set of procedures for isolating a single or a few proteins from a…
Q: Conversion question: 3.357 meters = 0.000003357 micrometers 3357 micrometers O 0.003357 micrometers…
A:
Q: 1. What is importance of inflammation in the immune response? 2. Describe when the inflammation is…
A: As per the guidelines, we are supposed to answer only one question. Since you have asked multiple…
Give a clear handwritten answer with explanation...please give handwritten answer
Step by step
Solved in 3 steps
- Nucleic Acids Convey polypeptide c' minal directi This ques similar to t' carboxy-ter- hesis ing synth to direct sis, the Secon yase aft e genetic groups of 44. Why is ATP important to protein function, and how is it used to accomplish this? which st is. The m fatthaei, synthetic able of r ataining r thus mus ucleotid h of mor Cwas the chemis re critir a 1966 ponded han our PROT mine the s tetail sizerHN, NH. NH H2N° А. В. Consider the 3 structures shown. Which of these is (normally) NOT present in either DNA or RNA? (select all that apply) А В none of the above ZI C.G-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart ac
- III. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…0ミレーNレ NH geometry on both cand N. Torigonal plannes CH - C-N o=), HN CH2 CH-C-OH (a- carbon) CH2 HooC Aspaxagine - Toline - Valine - Arginine - phenylalcmine - Glutamic ocid. 1.Give the name and three letter code for each amino acid in the peptide. e 2. At pH 7, approximately what charge would be on your peptide? Explain your answer. 3. Can your peptide form intra/interchain disulfide bonds? Explain why/why not. e 4. Will your peptide absorb UV and is it fluorescent? Explain why/why not. e 5. What is the probability that your peptide contains a cis peptide bond? Explain your answer.5'-TAGCTGATCGAATATGCGGTCTCTATCTTCGTAGACGA-3' 3'-ATCGACTAGCTTATACGCCAGAGATAGAAGCATCTGCT -5' Determine the amino acids that will be encoded by this sequence Second letter First letter U C A G U UUU Phe UUC UUA UUG Leu CUU CUC CUA CUG Leu GUU GUC GUA GUG Val UCU UCC UCA UCGJ AUU AUC lle AUA ACA AUG Met ACG CCU CCC C CCA CCG ACU ACC GCU GCC GCA GCG Ser - Pro Thr Ala A UGU UACTyr Cys UGC. UAA Stop UGA Stop A UAG Stop UGG Trp G CAC His CAA Gin CAG GAUT GAC Asp GAA AAU Asn ACC Ser AGU AAG LYS AA Glu GAGJ Oa. N-Met-Arg - Ser-Leu-Ser - Ser-C Ob. N-Met-Pro-Arg - Asn-Asp - Ser-C d. N-Met-Lys - Val-Glu-Ala-C Oc. N-Asp-Pro-Lys - Ser - Val-Ile-C Oe. N- Met-Ala-Asp-Pro-Lys - Ser-C G CGU CGC CGA CGG AGA AGG. GGU GGC GGA GGG Arg SCAO Gly U UCAG UUA DUAG Arg G Third letter 13
- Oh G A Stocking Stuffers | Artifact Uprising This is the sequence of a piece of DNA. TAC-ATA-ACG-CGA-CAA-CTA-AAA-ACT 1st letter Write the amino acid sequence of the protein that would be formed by translating this piece of DNA. You can use the three letter abbreviations for the amino acid in each box, do not use the name of the full amino acids. Use the abbreviation of the amino acid exactly as it is written in the table (including the appropriate capitalizations) For example, if your answer for amino acid 1 is "Methionine" you would write MET in the box (not Met or met) U UUC Phe UCU UCC UUA | UUG U AUU A AUC AUA AUG GUU G GUC GUA GUG Leu CUU CCU C CUC Leu CCC Pro CUA CUG 1st amino acid: UCA UCG lle CCA CCG ACU ACC ACA Met ACG GCU Val GCC GCA GCG Sequence of the protein: C Second Letter A Ser Thr Ala UAU UAC Tyr UAA Stop learn.maricopa.edu CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG 1 UAG Stop UGG Trp G His Gin Lys Asp Asn AGU AGC AGA AGG Glu CGU CGC UGU UGC UGA Stop A CGA CGG G |…Draw the peptide at a pH @1 of Cys-His-Glu-Met-Ile-Ser-Thr-Arg-Tyr - do it on this formatSecond letter A UUU UCU) UC UCA UCG UAU UUC Phe UUA Tyr UGU UGCJ Ser UAA Stop UGA Stop A UAG Stop UGG Trp UUG Leu CAUHIS CUU CUC CUA CUG CCU* C ССА CCG CGU His САС Leu CGC Arg CGA Pro CAA Gin CGGJ Gln Which amino acid is carried by the TRNA with the anticodon 5'-UCA-3? ACU ACC ACA AAU AAC. AGU AGC AGA AUU Ser Asn AUC Ile A AUA Thr AAA Lys AAG Lys AGG Arg AUG Met ACG GAU GGU] GUU GUC GUA GUGJ GCU GCC GCA GCG GAC Asp Ala GAA GGC Gly GGA Val GAG Glu GGGJ Isoleucine. None-this is a stop codon. Aspartic acid. Histidine. IV. Leucine O V. Third letter UCAG UCAG UCAG First letter
- I. A protein, X, was Isolated from a pathogenlc mlcroorganism. The proteln Is a vlrulence factor whose path0genlclty lies In a heptapeptide of unknown sequence. After trypsin cleavage of the heptapeptide from protein X, the peptlde's compOsition and sequence was determined. The fOllowing were the results of the sequenclng process: 1. When the peptide was treated with dinitrofluorobenzene (DNFB), DNP-asp and a mixture of amino acids were produced. 2. When the same Intact peptide was treated with streptococcal protease, a pentapeptide of composition asp, asN, cys, gly and ser and 2 amlno acids were released. 3. When the heptapeptlde was also treated with hydrOxylamine HCI, a tripeptide and a tetrapeptide were obtained. The C-terminal amino acid of the tripeptide was asN. 1) What is the sequence of the heptapeptide if it is composed of cys, asp, lys, asN, gly and ser only? 2) What is the pl of the heptapeptide?5' UGG CAA UCC UAC GAU 3' - 1. Here is the MRNA sequence from a section of a gene (it is the middle of the sequence, so it has no AUG). What is the template sequence of this gene? - 2. Are any of these codons in the MRNA non-degenerate? If so, indicate which one. e 3. 4 a) Translate this mRNA section. Give the 3 letter codes for the amino acids. b) Indicate on the peptide which is the C terminus and which is the N terminus. e 4. Is it possible for a single base pair substitution to cause a truncation in this peptide? If so, e explain how. e 5. Write out the sequence of the anticodon in the tRNA that would bind to the fourth codon in the e MRNA. e 6. Write out a possible miRNA that could regulate the expression of this geneSuggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSA